Anti-UPF3B antibody produced in rabbit | MilliporeSigma HPA001882 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-UPF3B antibody produced in rabbit

catalog :

HPA001882

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunoprecipitation

citations: 2

Published Application/Species/Sample/Dilution	Reference
immunoprecipitation; mouse; loading ...; fig 5a	Higa M, Oka M, Fujihara Y, Masuda K, Yoneda Y, Kishimoto T. Regulation of inflammatory responses by dynamic subcellular localization of RNA-binding protein Arid5a. Proc Natl Acad Sci U S A. 2018;115:E1214-E1220 pubmed publisher
	Notaras M, Allen M, Longo F, Volk N, Toth M, Li Jeon N, et al. UPF2 leads to degradation of dendritically targeted mRNAs to regulate synaptic plasticity and cognitive function. Mol Psychiatry. 2019;: pubmed publisher

product information

cat no :

HPA001882

brand :

SIGMA

name :

Anti-UPF3B antibody produced in rabbit

prod type :

Chemical

name suffix :

Ab2, Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Nonsense mRNA reducing factor 3B antibody produced in rabbit; Anti-Regulator of nonsense transcripts 3B antibody produced in rabbit; Anti-Up-frameshift suppressor 3 homolog B antibody produced in rabbit; Anti-hUpf3B antibody produced in rabbit; Anti-hUpf3p-X antibody produced in rabbit

unspsc code :

12352203

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable; indirect immunofluorescence: suitable

species reactivity :

human

immunogen :

Regulator of nonsense transcripts 3B recombinant protein epitope signature tag (PrEST)

immunogen sequence :

KEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQ
DRNKEKKEALSKVVIRRLPPTLTKEQLQEHLQPMPEHDY
FEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYV
FLDNKGQEYPAIVE

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.