This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-FGD1 antibody produced in rabbit
catalog :
HPA000911
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunocytochemistry
citations: 3
Published Application/Species/Sample/DilutionReference
  • immunocytochemistry; human; fig s1
Daubon T, Spuul P, Alonso F, Fremaux I, Genot E. VEGF-A stimulates podosome-mediated collagen-IV proteolysis in microvascular endothelial cells. J Cell Sci. 2016;129:2586-98 pubmed publisher
Thuault S, Mamelonet C, Salameh J, Ostacolo K, Chanez B, Salaün D, et al. A proximity-labeling proteomic approach to investigate invadopodia molecular landscape in breast cancer cells. Sci Rep. 2020;10:6787 pubmed publisher
Herrington K, Trinh A, Dang C, O Shaughnessy E, Hahn K, Gratton E, et al. Spatial analysis of Cdc42 activity reveals a role for plasma membrane-associated Cdc42 in centrosome regulation. Mol Biol Cell. 2017;28:2135-2145 pubmed publisher
product information
cat no :
HPA000911
brand :
SIGMA
name :
Anti-FGD1 antibody produced in rabbit
prod type :
Chemical
name suffix :
Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
storage :
-20C
storage temp :
-20C
physical form :
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
legal information :
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
shipped in :
wet ice
syns :
Anti-FYVE, RhoGEF and PH domain-containing protein 1 antibody produced in rabbit; Anti-Faciogenital dysplasia 1 protein antibody produced in rabbit; Anti-Rho/Rac GEF antibody produced in rabbit; Anti-Rho/Rac guanine nucleotide exchange factor FGD1 antibody produced in rabbit; Anti-Zinc finger FYVE domain-containing protein 3 antibody produced in rabbit
unspsc code :
12352203
wgk :
1
form :
buffered aqueous glycerol solution
antibody form :
affinity isolated antibody
application(s) :
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect immunofluorescence: suitable; protein array: suitable
species reactivity :
human
immunogen :
FYVE, RhoGEF and PH domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
immunogen sequence :
DSDPGASEPGLLARRGSGSALGGPLDPQFVGPSDTSLGA
APGHRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNR
ILVKSLSLDPGQSLEPHPEGPQRLRSDP
grade :
Prestige Antibodies(R) Powered by Atlas Antibodies
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information
MilliporeSigma
PO Box 14508
St. Louis, MO 63178
https://www.sigmaaldrich.com
1-800-325-3010
headquarters: USA