Anti-PSMC1 antibody produced in rabbit | MilliporeSigma HPA000872 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-PSMC1 antibody produced in rabbit

catalog :

HPA000872

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; 1:250; fig 2 western blot; human; 1:1000; fig 1 immunocytochemistry; mouse; 1:250; fig 3 western blot; mouse; 1:1000; fig 1	Czub B, Shah A, Alfano G, Kruczek P, Chakarova C, Bhattacharya S. TOPORS, a Dual E3 Ubiquitin and Sumo1 Ligase, Interacts with 26 S Protease Regulatory Subunit 4, Encoded by the PSMC1 Gene. PLoS ONE. 2016;11:e0148678 pubmed publisher

product information

cat no :

HPA000872

brand :

SIGMA

name :

Anti-PSMC1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-26S protease regulatory subunit 4 antibody produced in rabbit; Anti-P26s4 antibody produced in rabbit; Anti-Proteasome 26S subunit ATPase 1 antibody produced in rabbit

unspsc code :

12352203

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; western blot: suitable; indirect immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

26S protease regulatory subunit 4 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNR
IETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRM
TLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERR
MKVTNEDFKKSKENVLYKKQEGTPE

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.