This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-TMEM69 antibody produced in rabbit
catalog :
AV47258
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, chicken, zebrafish
application :
western blot, immunohistochemistry
product information
cat no :
AV47258
brand :
SIGMA
name :
Anti-TMEM69 antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
ncbi accession no :
NP_057570
syns :
Anti-C1orf154; Anti-FLJ21029; Anti-MGC104183; Anti-RP11-767N6.4; Anti-Transmembrane protein 69
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
immunohistochemistry: suitable; western blot: suitable
species reactivity :
chicken, rat, human, zebrafish, mouse
immunogen :
synthetic peptide corresponding to a region of human TMEM69 with an internal ID of Y01363
immunogen sequence :
RWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISERL
SEAIVTVIMGM
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information
MilliporeSigma
PO Box 14508
St. Louis, MO 63178
https://www.sigmaaldrich.com
1-800-325-3010
headquarters: USA