Anti-FHOD3 antibody produced in rabbit | MilliporeSigma AV46342 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-FHOD3 antibody produced in rabbit

catalog :

AV46342

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, bovine

application :

western blot, immunohistochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; rat; loading ...; fig 7e	Monzo P, Chong Y, Guetta Terrier C, Krishnasamy A, Sathe S, Yim E, et al. Mechanical confinement triggers glioma linear migration dependent on formin FHOD3. Mol Biol Cell. 2016;27:1246-61 pubmed publisher

product information

cat no :

AV46342

brand :

SIGMA

name :

Anti-FHOD3 antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

ncbi accession no :

NP_079411

syns :

Anti-FHOS2; Anti-Formactin2; Anti-Formin homology 2 domain containing 3

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable; immunohistochemistry: suitable

species reactivity :

human, mouse, rat, bovine

immunogen :

synthetic peptide corresponding to a region of human FHOD3 with an internal ID of P27128

immunogen sequence :

KMITDSGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVL
KTSSPSVEDAT

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.