This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-MRPS12 antibody produced in rabbit
catalog :
AV46301
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat, dogs, bovine
application :
western blot
product information
cat no :
AV46301
brand :
SIGMA
name :
Anti-MRPS12 antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
ncbi accession no :
NP_066930
syns :
Anti-MPR-S12; Anti-MT-RPS12; Anti-Mitochondrial ribosomal protein S12; Anti-RPMS12; Anti-RPS12; Anti-RPSM12
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
canine, human, rat, bovine
immunogen :
synthetic peptide corresponding to a region of human MRPS12 with an internal ID of S17811
immunogen sequence :
MHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPN
SANRKCCRVRL
SANRKCCRVRL
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information

MilliporeSigma
questions and comments
