Anti-PTPRR antibody produced in rabbit | MilliporeSigma AV45387 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-PTPRR antibody produced in rabbit

catalog :

AV45387

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, chicken, bovine

application :

western blot

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:2000; fig st1	Treindl F, Ruprecht B, Beiter Y, Schultz S, Döttinger A, Staebler A, et al. A bead-based western for high-throughput cellular signal transduction analyses. Nat Commun. 2016;7:12852 pubmed publisher

product information

cat no :

AV45387

brand :

SIGMA

name :

Anti-PTPRR antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

ncbi accession no :

NP_570897

syns :

Anti-DKFZp781C1038; Anti-EC-PTP; Anti-FLJ34328; Anti-MGC131968; Anti-MGC148170; Anti-PCPTP1; Anti-PTP-SL; Anti-Protein tyrosine phosphatase, receptor type, R

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

bovine, human, mouse, rat, canine, chicken,

immunogen :

synthetic peptide corresponding to a region of human PTPRR with an internal ID of P26358

immunogen sequence :

HTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLAS
QGRGPVVVHCS

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.