This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-RCOR1 antibody produced in rabbit
catalog :
AV39179
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, dog, chicken
application :
western blot
product information
cat no :
AV39179
brand :
SIGMA
name :
Anti-RCOR1 antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
ncbi accession no :
NP_055971
syns :
Anti-REST corepressor 1
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
canine, human, chicken, mouse
immunogen :
synthetic peptide corresponding to a region of human RCOR1 with an internal ID of P21284
immunogen sequence :
EVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDE
APVLDVRYASA
APVLDVRYASA
company information

MilliporeSigma
questions and comments
