This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-SITPEC antibody produced in rabbit
catalog :
AV37176
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dog, cow
application :
western blot
product information
cat no :
AV37176
brand :
SIGMA
name :
Anti-SITPEC antibody produced in rabbit
prod type :
Chemical
name suffix :
IgG fraction of antiserum, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
ncbi accession no :
NP_036159
form :
lyophilized powder
antibody form :
IgG fraction of antiserum
application(s) :
western blot: suitable
species reactivity :
human, canine, rat, bovine, mouse
immunogen :
synthetic peptide corresponding to a region of human Sitpec with an internal ID of P09403
immunogen sequence :
TGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGPFP
LWLRNKCVYYH
LWLRNKCVYYH
company information

MilliporeSigma
questions and comments
