Anti-HEYL antibody produced in rabbit | MilliporeSigma AV31866 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-HEYL antibody produced in rabbit

catalog :

AV31866

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; rat; 1:1000; loading ...; fig 4b	Zeng J, Jing Y, Shi R, Pan X, Lai F, Liu W, et al. Autophagy regulates biliary differentiation of hepatic progenitor cells through Notch1 signaling pathway. Cell Cycle. 2016;15:1602-10 pubmed publisher

product information

cat no :

AV31866

brand :

SIGMA

name :

Anti-HEYL antibody produced in rabbit

prod type :

Chemical

name suffix :

IgG fraction of antiserum, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

ncbi accession no :

NP_055386

syns :

Anti-Hairy/enhancer-of-split related with YRPW motif-like

form :

lyophilized powder

antibody form :

IgG fraction of antiserum

application(s) :

western blot: suitable

species reactivity :

bovine, human, mouse, rat, canine

immunogen :

synthetic peptide corresponding to a region of human HEYL with an internal ID of P02661

immunogen sequence :

KRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQ
MQARKKRRGII

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.