product summary
Loading...
company name :
SICGEN
product type :
antibody
product name :
anti-Azurin
catalog :
AB0048-100
quantity :
300 µg
price :
320 euros
clonality :
polyclonal
host :
domestic goat
conjugate :
nonconjugated
application :
western blot
more info or order :
citations: 1
product information
sic :
AB0048-100
product name :
anti-Azurin
ab type :
Polyclonal
purification :
epitope affinity purified
recommended applications without primary ... :
WB
validated applications :
WB
antigen :
Purified recombinant Burkholderia azurin protein produced in E. coli.
specificity :
Detects azurin by Western blot.
antigen sequence :
MLRKLLVPVASPLILLGPSSAECSVDIQGNDEMQKNTNA
ITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQG
VVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTF
DVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
ITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQG
VVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTF
DVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
host :
goat
reactivity :
bacteria, Pseudomonas, Burkholderia
conjugation :
Unconjugated
isotype :
IgG
vial size :
100
concentration :
3
size :
300 µg
storage :
For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.
handling :
The antibody solution should be gently mixed before use.
sic :
AB0048-100
new_price _Euros :
320 euros
more info or order :
company information

SICGEN
BIOCANT II
Parque Tecnológico de Cantanhede
3060-197 Cantanhede
Parque Tecnológico de Cantanhede
3060-197 Cantanhede
orders@sicgen.pt
http://www.sicgen.pt351 21 458 28 04
headquarters: PORTUGAL
browse more products
questions and comments
