product summary
Loading...
company name :
R&D Systems
product type :
antibody
product name :
Human/Rat Osteocalcin Antibody
catalog :
MAB1419
quantity :
100 ug (also 25 ug)
price :
539 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
190125
reactivity :
human, mouse, rat, dogs
application :
immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 55
Reference
Yu Y, Lee S, Bock M, An S, Shin H, Rim J, et al. Promotion of Bone Formation in a Rat Osteoporotic Vertebral Body Defect Model via Suppression of Osteoclastogenesis by Ectopic Embryonic Calvaria Derived Mesenchymal Stem Cells. Int J Mol Sci. 2024;25: pubmed publisher
C xe1 rdenas Aguazaco W, Camacho B, G xf3 mez Pach xf3 n E, Lara Bertrand A, Silva Cote I. Electrospun Scaffolds of Polylactic Acid, Collagen, and Amorphous Calcium Phosphate for Bone Repair. Pharmaceutics. 2023;15: pubmed publisher
Yin S, Lin S, Xu J, Yang G, Chen H, Jiang X. Dominoes with interlocking consequences triggered by zinc: involvement of microelement-stimulated MSC-derived exosomes in senile osteogenesis and osteoclast dialogue. J Nanobiotechnology. 2023;21:346 pubmed publisher
Umrath F, Schmitt L, Kliesch S, Schille C, Geis Gerstorfer J, Gurewitsch E, et al. Mechanical and Functional Improvement of β-TCP Scaffolds for Use in Bone Tissue Engineering. J Funct Biomater. 2023;14: pubmed publisher
Dushime H, Moreno S, Linard C, Adrait A, Cout xe9 Y, Peltzer J, et al. Fetal Muse-based therapy prevents lethal radio-induced gastrointestinal syndrome by intestinal regeneration. Stem Cell Res Ther. 2023;14:201 pubmed publisher
Gómez Sequeda N, Mendivil Perez M, Jimenez Del Rio M, Lopera F, Velez Pardo C. Cholinergic-like neurons and cerebral spheroids bearing the PSEN1 p.Ile416Thr variant mirror Alzheimer's disease neuropathology. Sci Rep. 2023;13:12833 pubmed publisher
Jinteng L, Peitao X, Wenhui Y, Guiwen Y, Feng Y, Xiaojun X, et al. BMAL1-TTK-H2Bub1 loop deficiency contributes to impaired BM-MSC-mediated bone formation in senile osteoporosis. Mol Ther Nucleic Acids. 2023;31:568-585 pubmed publisher
Grissom S, Semevolos S, Duesterdieck Zellmer K. Role of cartilage and bone matrix regulation in early equine osteochondrosis. Bone Rep. 2023;18:101653 pubmed publisher
Verisqa F, Cha J, Nguyen L, Kim H, Knowles J. Digital Light Processing 3D Printing of Gyroid Scaffold with Isosorbide-Based Photopolymer for Bone Tissue Engineering. Biomolecules. 2022;12: pubmed publisher
Chan N, Lee M, Wang Y, Galipeau J, Li W, Xu W. CTR9 drives osteochondral lineage differentiation of human mesenchymal stem cells via epigenetic regulation of BMP-2 signaling. Sci Adv. 2022;8:eadc9222 pubmed publisher
Diez Escudero A, Carlsson E, Andersson B, J xe4 rhult J, Hailer N. Trabecular Titanium for Orthopedic Applications: Balancing Antimicrobial with Osteoconductive Properties by Varying Silver Contents. ACS Appl Mater Interfaces. 2022;14:41751-41763 pubmed publisher
Zhang X, Jiang W, Xie C, Wu X, Ren Q, Wang F, et al. Msx1+ stem cells recruited by bioactive tissue engineering graft for bone regeneration. Nat Commun. 2022;13:5211 pubmed publisher
Gao X, Hwang M, Wright N, Lu A, Ruzbarsky J, Huard M, et al. The use of heparin/polycation coacervate sustain release system to compare the bone regenerative potentials of 5 BMPs using a critical sized calvarial bone defect model. Biomaterials. 2022;288:121708 pubmed publisher
Giner M, V xe1 zquez G xe1 mez M, Miranda M, Bocio Nu xf1 ez J, Olmo Montes F, Rico M, et al. Circulating Osteogenic Progenitor Cells Enhanced with Teriparatide or Denosumab Treatment. J Clin Med. 2022;11: pubmed publisher
Ribeiro J, Domingues R, Babo P, Nogueira L, Reseland J, Reis R, et al. Highly elastic and bioactive bone biomimetic scaffolds based on platelet lysate and biomineralized cellulose nanocrystals. Carbohydr Polym. 2022;292:119638 pubmed publisher
Zhang B, Xiao M, Cheng X, Bai Y, Chen H, Yu Q, et al. Enamel Matrix Derivative Enhances the Odontoblastic Differentiation of Dental Pulp Stem Cells via Activating MAPK Signaling Pathways. Stem Cells Int. 2022;2022:2236250 pubmed publisher
Luchman N, Megat Abdul Wahab R, Zainal Ariffin S, Nasruddin N, Lau S, Yazid F. Comparison between hydroxyapatite and polycaprolactone in inducing osteogenic differentiation and augmenting maxillary bone regeneration in rats. Peerj. 2022;10:e13356 pubmed publisher
Li Z, Lin Z, Liu S, Yagi H, Zhang X, Yocum L, et al. Human Mesenchymal Stem Cell-Derived Miniature Joint System for Disease Modeling and Drug Testing. Adv Sci (Weinh). 2022;9:e2105909 pubmed publisher
Martin Iglesias S, Milian L, Sancho Tello M, Salvador Clavell R, Martín de Llano J, Carda C, et al. BMP-2 Enhances Osteogenic Differentiation of Human Adipose-Derived and Dental Pulp Stem Cells in 2D and 3D In Vitro Models. Stem Cells Int. 2022;2022:4910399 pubmed publisher
Heydt Q, Xintaropoulou C, Clear A, Austin M, Pislariu I, Miraki Moud F, et al. Adipocytes disrupt the translational programme of acute lymphoblastic leukaemia to favour tumour survival and persistence. Nat Commun. 2021;12:5507 pubmed publisher
E L, Lu R, Sun J, Li H, Xu W, Xing H, et al. Microenvironment Influences on Human Umbilical Cord Mesenchymal Stem Cell-Based Bone Regeneration. Stem Cells Int. 2021;2021:4465022 pubmed publisher
Acharya T, Kumar S, Tiwari N, Ghosh A, Tiwari A, Pal S, et al. TRPM8 channel inhibitor-encapsulated hydrogel as a tunable surface for bone tissue engineering. Sci Rep. 2021;11:3730 pubmed publisher
Lv S, Xu J, Chen L, Wu H, Feng W, Zheng Y, et al. MicroRNA-27b targets CBFB to inhibit differentiation of human bone marrow mesenchymal stem cells into hypertrophic chondrocytes. Stem Cell Res Ther. 2020;11:392 pubmed publisher
Liang C, Liu Z, Song M, Li W, Wu Z, Wang Z, et al. Stabilization of heterochromatin by CLOCK promotes stem cell rejuvenation and cartilage regeneration. Cell Res. 2021;31:187-205 pubmed publisher
Wei Q, Wang B, Hu H, Xie C, Ling L, Gao J, et al. Icaritin promotes the osteogenesis of bone marrow mesenchymal stem cells via the regulation of sclerostin expression. Int J Mol Med. 2020;45:816-824 pubmed publisher
Chen J, Tu C, Tang X, Li H, Yan J, Ma Y, et al. The combinatory effect of sinusoidal electromagnetic field and VEGF promotes osteogenesis and angiogenesis of mesenchymal stem cell-laden PCL/HA implants in a rat subcritical cranial defect. Stem Cell Res Ther. 2019;10:379 pubmed publisher
Miceli V, Pampalone M, Vella S, Carreca A, Amico G, Conaldi P. Comparison of Immunosuppressive and Angiogenic Properties of Human Amnion-Derived Mesenchymal Stem Cells between 2D and 3D Culture Systems. Stem Cells Int. 2019;2019:7486279 pubmed publisher
Loebel C, Mauck R, Burdick J. Local nascent protein deposition and remodelling guide mesenchymal stromal cell mechanosensing and fate in three-dimensional hydrogels. Nat Mater. 2019;: pubmed publisher
Kolb A, Shupp A, Mukhopadhyay D, Marini F, Bussard K. Osteoblasts are "educated" by crosstalk with metastatic breast cancer cells in the bone tumor microenvironment. Breast Cancer Res. 2019;21:31 pubmed publisher
Kapelouzou A, Kontogiannis C, Tsilimigras D, Georgiopoulos G, Kaklamanis L, Tsourelis L, et al. Differential expression patterns of Toll Like Receptors and Interleukin-37 between calcific aortic and mitral valve cusps in humans. Cytokine. 2019;116:150-160 pubmed publisher
Gao X, Lu A, Tang Y, Schneppendahl J, Liebowitz A, Scibetta A, et al. Influences of donor and host age on human muscle-derived stem cell-mediated bone regeneration. Stem Cell Res Ther. 2018;9:316 pubmed publisher
Eyvazi M, Farahzadi R, Karimian Fathi N, Karimipour M, Soleimani Rad J, Montaseri A. Mummy Material Can Promote Differentiation of Adipose Derived Stem Cells into Osteoblast through Enhancement of Bone Specific Transcription Factors Expression. Adv Pharm Bull. 2018;8:457-464 pubmed publisher
Zhu Y, Wu Y, Cheng J, Wang Q, Li Z, Wang Y, et al. Pharmacological activation of TAZ enhances osteogenic differentiation and bone formation of adipose-derived stem cells. Stem Cell Res Ther. 2018;9:53 pubmed publisher
Amer M, Rose F, Shakesheff K, White L. A biomaterials approach to influence stem cell fate in injectable cell-based therapies. Stem Cell Res Ther. 2018;9:39 pubmed publisher
Arianna C, Eliana C, Flavio A, Marco R, Giacomo D, Manuel S, et al. Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds. Stem Cells Int. 2017;2017:2976541 pubmed publisher
Lisignoli G, Lambertini E, Manferdini C, Gabusi E, Penolazzi L, Paolella F, et al. Collagen type XV and the 'osteogenic status'. J Cell Mol Med. 2017;21:2236-2244 pubmed publisher
Tatebayashi K, Tanaka Y, Nakano Doi A, Sakuma R, Kamachi S, Shirakawa M, et al. Identification of Multipotent Stem Cells in Human Brain Tissue Following Stroke. Stem Cells Dev. 2017;26:787-797 pubmed publisher
Lou Y, Toh T, Tee Y, Yu H. 25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells. Sci Rep. 2017;7:42816 pubmed publisher
Kim S, Das A, Chai J, Binas B, Choi M, Park K, et al. Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand. Sci Rep. 2016;6:30311 pubmed publisher
Lowndes M, Rotherham M, Price J, El Haj A, Habib S. Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering. Stem Cell Reports. 2016;7:126-37 pubmed publisher
Nasiri N, Ceramidas A, Mukherjee S, Panneerselvan A, Nisbet D, Tricoli A. Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration. Sci Rep. 2016;6:24305 pubmed publisher
Kapelouzou A, Tsourelis L, Kaklamanis L, Degiannis D, Kogerakis N, Cokkinos D. Serum and tissue biomarkers in aortic stenosis. Glob Cardiol Sci Pract. 2015;2015:49 pubmed publisher
Qian G, Fan W, Ahlemeyer B, Karnati S, Baumgart Vogt E. Peroxisomes in Different Skeletal Cell Types during Intramembranous and Endochondral Ossification and Their Regulation during Osteoblast Differentiation by Distinct Peroxisome Proliferator-Activated Receptors. PLoS ONE. 2015;10:e0143439 pubmed publisher
Zhu W, Zhang Q, Zhang Y, Cen L, Wang J. PDL regeneration via cell homing in delayed replantation of avulsed teeth. J Transl Med. 2015;13:357 pubmed publisher
Carpentieri A, Cozzoli E, Scimeca M, Bonanno E, Sardanelli A, Gambacurta A. Differentiation of human neuroblastoma cells toward the osteogenic lineage by mTOR inhibitor. Cell Death Dis. 2015;6:e1974 pubmed publisher
Yao R, Wong J. The effects of mechanical stimulation on controlling and maintaining marrow stromal cell differentiation into vascular smooth muscle cells. J Biomech Eng. 2015;137:020907 pubmed publisher
Pereira R, Delany A, Khouzam N, Bowen R, Freymiller E, Salusky I, et al. Primary osteoblast-like cells from patients with end-stage kidney disease reflect gene expression, proliferation, and mineralization characteristics ex vivo. Kidney Int. 2015;87:593-601 pubmed publisher
Marfia G, Navone S, Di Vito C, Tabano S, Giammattei L, Di Cristofori A, et al. Gene expression profile analysis of human mesenchymal stem cells from herniated and degenerated intervertebral discs reveals different expression of osteopontin. Stem Cells Dev. 2015;24:320-8 pubmed publisher
Xia H, Bodempudi V, Benyumov A, Hergert P, Tank D, Herrera J, et al. Identification of a cell-of-origin for fibroblasts comprising the fibrotic reticulum in idiopathic pulmonary fibrosis. Am J Pathol. 2014;184:1369-83 pubmed publisher
Govindarajan P, Bocker W, El Khassawna T, Kampschulte M, Schlewitz G, Huerter B, et al. Bone matrix, cellularity, and structural changes in a rat model with high-turnover osteoporosis induced by combined ovariectomy and a multiple-deficient diet. Am J Pathol. 2014;184:765-77 pubmed publisher
Reinhardt P, Glatza M, Hemmer K, Tsytsyura Y, Thiel C, Höing S, et al. Derivation and expansion using only small molecules of human neural progenitors for neurodegenerative disease modeling. PLoS ONE. 2013;8:e59252 pubmed publisher
Poundarik A, Diab T, Sroga G, Ural A, Boskey A, Gundberg C, et al. Dilatational band formation in bone. Proc Natl Acad Sci U S A. 2012;109:19178-83 pubmed publisher
Asumda F, Chase P. Age-related changes in rat bone-marrow mesenchymal stem cell plasticity. BMC Cell Biol. 2011;12:44 pubmed publisher
Curran J, Chen R, Hunt J. The guidance of human mesenchymal stem cell differentiation in vitro by controlled modifications to the cell substrate. Biomaterials. 2006;27:4783-93 pubmed
Krout A, Wen H, Hippensteel E, Li P. A hybrid coating of biomimetic apatite and osteocalcin. J Biomed Mater Res A. 2005;73:377-87 pubmed
product information
brand :
R&D Systems
master code :
MAB1419
SKU :
MAB1419
product name :
Human/Rat Osteocalcin Antibody
unit size :
100 ug (also 25 ug)
seo description :
The Human/Rat Osteocalcin Antibody from R&D Systems is a mouse monoclonal antibody to Osteocalcin. This antibody reacts with canine,equine,human,mouse,rat. The Human/Rat Osteocalcin Antibody has been validated for the following applications: Immunohistochemistry,Immunocytochemistry,Flow Cytometry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Intracellular Staining by Flow Cytometry,CyTOF-ready.
target :
Osteocalcin
category :
Primary Antibodies
buffer :
Lyophilized from a 0.2 ╡m filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 ╡m filtered solution in PBS.
clonality :
Monoclonal
clone :
190125
concentration :
LYOPH
conjugate :
Unconjugated
dilution :
Immunohistochemistry 8-25 ug/mL, Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells, Immunocytochemistry 8-25 ug/mL, CyTOF-ready
host :
Mouse
immunogen :
Accession # P02818
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQ
EAYRRFYGPV,
Human Osteocalcin synthetic peptide,
isotype :
IgG1
purity :
Protein A or G purified from hybridoma culture supernatant
species :
Canine,Equine,Human,Mouse,Rat
specificity :
Detects human Osteocalcin in direct ELISAs.
gene symbol :
BGLAP
top caption :
Osteocalcin antibody in MG-63 Human Cell Line by Immunocytochemistry (ICC).
accessionNumbers :
P02818
applications :
Intracellular Staining by Flow Cytometry,CyTOF-ready,Flow Cytometry,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry,Immunocytochemistry/ Immunofluorescence
USD :
539 USD
alt names :
BGLAP, BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin
storage :
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 ░C as supplied. 1 month, 2 to 8 ░C under sterile conditions after reconstitution. 6 months, -20 to -70 ░C under sterile conditions after reconstitution.
more info or order :
company information
R&D Systems
614 McKinley Place N.E.
Minneapolis, MN 55413
info@RnDSystems.com
https://www.rndsystems.com
800 343-7475
headquarters: USA
R&D Systems develops and manufactures high-quality proteins and serves as a world leader in immunoassays. R&D Systems also produces quality antibodies, antibody arrays, stem cell and cell culture products, and cell selection and detection products, serving the life science and diagnostics industry.