Human Osteocalcin PE-conjugated Antibody | R&D Systems IC1419P product information

product summary

company name :

R&D Systems

product type :

antibody

product name :

Human Osteocalcin PE-conjugated Antibody

catalog :

IC1419P

quantity :

100 Tests

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

clone name :

190125

reactivity :

human

application :

flow cytometry

more info or order :

R&D Systems product webpage

citations: 7

Reference
Vigili de Kreutzenberg S, Giannella A, Ceolotto G, Faggin E, Cappellari R, Mazzucato M, et al. A miR-125/Sirtuin-7 pathway drives the pro-calcific potential of myeloid cells in diabetic vascular disease. Diabetologia. 2022;: pubmed publisher
Chan Y, Ngai M, Chen Y, Wu M, Yu Y, Zhen Z, et al. Cumulative Rheumatic Inflammation Modulates the Bone-Vascular Axis and Risk of Coronary Calcification. J Am Heart Assoc. 2019;8:e011540 pubmed publisher
Sassi F, Buondonno I, Luppi C, Spertino E, Stratta E, Di Stefano M, et al. Type 2 diabetes affects bone cells precursors and bone turnover. BMC Endocr Disord. 2018;18:55 pubmed publisher
Gunawardene P, Al Saedi A, Singh L, Bermeo S, Vogrin S, Phu S, et al. Age, gender, and percentage of circulating osteoprogenitor (COP) cells: The COP Study. Exp Gerontol. 2017;96:68-72 pubmed publisher
Spina A, Montella R, Liccardo D, De Rosa A, Laino L, Mitsiadis T, et al. NZ-GMP Approved Serum Improve hDPSC Osteogenic Commitment and Increase Angiogenic Factor Expression. Front Physiol. 2016;7:354 pubmed publisher
Resende A, dos Reis L, Dias C, Custódio M, Jorgetti V, Woronik V. Bone disease in newly diagnosed lupus nephritis patients. PLoS ONE. 2014;9:e106728 pubmed publisher
Paino F, La Noce M, Tirino V, Naddeo P, Desiderio V, Pirozzi G, et al. Histone deacetylase inhibition with valproic acid downregulates osteocalcin gene expression in human dental pulp stem cells and osteoblasts: evidence for HDAC2 involvement. Stem Cells. 2014;32:279-89 pubmed publisher

product information

master code :

IC1419P

SKU :

IC1419P

product name :

Human Osteocalcin PE-conjugated Antibody

unit size :

100 Tests

description :

The Human Osteocalcin PE-conjugated Antibody from R&D Systems is a mouse monoclonal antibody to Osteocalcin. This antibody reacts with human. The Human Osteocalcin PE-conjugated Antibody has been validated for the following applications: Flow Cytometry,Intracellular Staining by Flow Cytometry.

target :

Osteocalcin

category :

Primary Antibodies

buffer :

Supplied in a saline solution containing BSA and Sodium Azide.

clonality :

Monoclonal

clone :

190125

conjugate :

Phycoerythrin

host :

Mouse

immunogen :

Accession # P02818
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQ
EAYRRFYGPV,
Human Osteocalcin synthetic peptide,

isotype :

IgG1

purity :

Protein A or G purified from hybridoma culture supernatant

species :

Human

specificity :

Detects human Osteocalcin in direct ELISAs.

gene symbol :

BGLAP

top caption :

Detection of Osteocalcin antibody in Differentiated Human Mesemchymal Progenitor Cells antibody by Flow Cytometry.

accessionNumbers :

P02818

applications :

Flow Cytometry,Intracellular Staining by Flow Cytometry

USD :

399 USD

alt names :

BGLAP, BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin

storage :

Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 ░C as supplied.

more info or order :

R&D Systems product webpage