product summary
Loading...
company name :
R&D Systems
product type :
protein
product name :
Recombinant Human CD44v6 Fc Chimera Protein, CF
catalog :
11175-CD-050
quantity :
50 ug
price :
484 USD
more info or order :
R&D Systems product webpage
product information
master code :
11175-CD
SKU :
11175-CD-050
product name :
Recombinant Human CD44v6 Fc Chimera Protein, CF
unit size :
50 ug
description :
The Recombinant Human CD44v6 Fc Chimera Protein, CF from R&D Systems is derived from CHO. The Recombinant Human CD44v6 Fc Chimera Protein, CF has been validated for the following applications: Bioactivity.
target :
CD44
category :
Proteins and Enzymes
buffer :
Lyophilized from a 0.2 ╡m filtered solution in PBS with Trehalose.
conjugate :
Unconjugated
purity :
>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie« Blue Staining.
species :
Human
observed molecular weight :
105-120 kDa, under reducing conditions.
theoretical molecular weight :
59 kDa
details of functionality :
Measured by its binding ability in a functional ELISA. When Recombinant Human CD44v6 Fc Chimera (Catalog # 11175-CD) is immobilized at 1 ╡g/mL (100 ╡L/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.
endotoxin note :
<0.10 EU per 1 ╡g of the protein by the LAL method.
accessionNumbers :
NP_001001391.1
applications :
Bioactivity
source long :
Accession # NP_001001391.1 GGIEGRMD Human IgG1 (Pro100-Lys330) N-terminus C-terminus
(IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHS
TTGTAG)(Asp224-Trp269)
Chinese Hamster Ovary cell line, CHO-derived human CD44 protein Human CD44v6 (Gln21-Thr222)
source short :
CHO
USD :
484 USD
alt names :
CD44, CD44 antigen, CD44 molecule (Indian blood group), CD44R, CDw44, cell surface glycoprotein CD44, chondroitin sulfate proteoglycan 8, CSPG8, ECMR-III, Epican, Extracellular matrix receptor III, GP90 lymphocyte homing/adhesion receptor, HCAM, HCELL, hematopoietic cell E- and L-selectin ligand, Heparan sulfate proteoglycan, Hermes antigen, homing function and Indian blood group system, HUTCH-I, Hyaluronate receptor, IN, LHR, MC56, MDU2, MDU2CD44 antigen (homing function and Indian blood group system), MDU3, MDU3CDW44, MIC4, MIC4MGC10468, MUTCH-I, Pgp1, PGP-1, PGP-I, Phagocytic glycoprotein 1, Phagocytic glycoprotein I
storage :
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 ░C as supplied. 1 month, 2 to 8 ░C under sterile conditions after reconstitution. 3 months, -20 to -70 ░C under sterile conditions after reconstitution.
more info or order :
R&D Systems product webpage
company information
R&D Systems
614 McKinley Place N.E.
Minneapolis, MN 55413
info@RnDSystems.com
https://www.rndsystems.com
800 343-7475
headquarters: USA
R&D Systems develops and manufactures high-quality proteins and serves as a world leader in immunoassays. R&D Systems also produces quality antibodies, antibody arrays, stem cell and cell culture products, and cell selection and detection products, serving the life science and diagnostics industry.