product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Myelin PLP Antibody - BSA Free
catalog :
NBP3-35912-100ul
quantity :
100 ul (also 20 ul)
price :
509 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-35912
SKU :
NBP3-35912-100ul
product name :
Myelin PLP Antibody - BSA Free
unit size :
100 ul (also 20 ul)
description :
The Myelin PLP Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Myelin PLP. This antibody reacts with human,mouse,rat. The Myelin PLP Antibody - BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Myelin PLP
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
GFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRG
QHQAHSLERVCHCLGKWLGHPD
Recombinant fusion protein containing a sequence corresponding to amino acids 90-150 of human Myelin PLP (NP_000524.3).,, Sequence:,
QHQAHSLERVCHCLGKWLGHPD
Recombinant fusion protein containing a sequence corresponding to amino acids 90-150 of human Myelin PLP (NP_000524.3).,, Sequence:,
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
theoretical molecular weight :
30 kDa
gene symbol :
PLP1
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
509 USD
alt names :
HLD1, lipophilin, major myelin proteolipid protein, MMPL, myelin proteolipid protein, PLP, PLP/DM20, PMD, proteolipid protein 1, spastic paraplegia 2, uncomplicated, SPG2
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
browse more products
questions and comments
