product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
GPR109B/HM74 Antibody - BSA Free
catalog :
NBP3-35830-100ul
quantity :
100 ul (also 20 ul)
price :
509 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-35830
SKU :
NBP3-35830-100ul
product name :
GPR109B/HM74 Antibody - BSA Free
unit size :
100 ul (also 20 ul)
description :
The GPR109B/HM74 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to GPR109B/HM74. This antibody reacts with human,mouse,rat. The GPR109B/HM74 Antibody - BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
GPR109B/HM74
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
SFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKT
RGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPAS
LEKQLGCCIE
A synthetic peptide corresponding to a sequence within amino acids 300-392 of human GPR109B/HM74 (NP_006009.2).,, Sequence:,
RGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPAS
LEKQLGCCIE
A synthetic peptide corresponding to a sequence within amino acids 300-392 of human GPR109B/HM74 (NP_006009.2).,, Sequence:,
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
theoretical molecular weight :
44 kDa
gene symbol :
HCAR3
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
509 USD
alt names :
G protein-coupled receptor 109B, G-protein coupled receptor 109B, G-protein coupled receptor HM74, G-protein coupled receptor HM74B, GTP-binding protein, HCA3, HCAR3, HM74B, HM74Puma-g, Niacin receptor 2, NIACR2, Nicotinic acid receptor 2, PUMAG, putative chemokine receptor
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
