product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
HLA DPB1 Antibody - BSA Free
catalog :
NBP3-35186-100ul
quantity :
100 ul (also 20 ul)
price :
509 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-35186
SKU :
NBP3-35186-100ul
product name :
HLA DPB1 Antibody - BSA Free
unit size :
100 ul (also 20 ul)
description :
The HLA DPB1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to HLA DPB1. This antibody reacts with human,mouse. The HLA DPB1 Antibody - BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
HLA DPB1
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFD
SDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCR
HNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHV
TDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQIL
VMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARS
K
Recombinant fusion protein containing a sequence corresponding to amino acids 30-225 of human HLA DPB1 (NP_002112.3).,, Sequence:,
SDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCR
HNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHV
TDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQIL
VMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARS
K
Recombinant fusion protein containing a sequence corresponding to amino acids 30-225 of human HLA DPB1 (NP_002112.3).,, Sequence:,
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse
theoretical molecular weight :
29 kDa
gene symbol :
HLA-DPB1
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
509 USD
alt names :
DP beta 1 chain, DPB1, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA DP14-beta chain, HLA-DP histocompatibility type, beta-1 subunit, HLA-DP1B, HLA-DPB, major histocompatibility complex class II HLA DPB1 protein, major histocompatibility complex, class II, DP beta 1, MHC class II antigen beta chain, MHC class II antigen DP beta 1 chain, MHC class II antigen DPB1, MHC class II antigen DPbeta1, MHC class II HLA-DP-beta, MHC HLA DPB1
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
