product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
p73 Antibody - BSA Free
catalog :
NBP3-35073-100ul
quantity :
100 ul (also 20 ul)
price :
509 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-35073
SKU :
NBP3-35073-100ul
product name :
p73 Antibody - BSA Free
unit size :
100 ul (also 20 ul)
description :
The p73 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to p73. This antibody reacts with human,mouse. The p73 Antibody - BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
p73
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTI
EDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSS
NAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPG
GGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
Recombinant fusion protein containing a sequence corresponding to amino acids 487-636 of human p73 (NP_005418.1).,, Sequence:,
EDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSS
NAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPG
GGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
Recombinant fusion protein containing a sequence corresponding to amino acids 487-636 of human p73 (NP_005418.1).,, Sequence:,
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse
theoretical molecular weight :
70 kDa
gene symbol :
TP73
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
509 USD
alt names :
p53-related protein, P73p53-like transcription factor, TA p73, TAp73, tumor protein p73
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
- C1orf146 Antibody - Azide and BSA Free | NBP3-15597-100ul
- MUC2 Antibody (MLP/842) - Azide and BSA Free | NBP2-47685-0.1mg
- Cytokeratin 10 Antibody (KRT10/844) - Azide and BSA Free | NBP2-47825-0.1mg
- p57 Kip2 Antibody (KIP2/880) - Azide and BSA Free | NBP2-47766-0.1mg
- Chromogranin A Antibody (CHGA/777) - Azide and BSA Free | NBP2-47848-0.1mg
questions and comments
