product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
UCP1/3 Antibody (0S10O10)
catalog :
NBP3-33199-100ul
quantity :
100 ul (also 20 ul)
price :
469 USD
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
0S10O10
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-33199
SKU :
NBP3-33199-100ul
product name :
UCP1/3 Antibody (0S10O10)
unit size :
100 ul (also 20 ul)
description :
The UCP1/3 Antibody (0S10O10) from Novus is a rabbit monoclonal antibody to UCP1/3. This antibody reacts with mouse,rat. The UCP1/3 Antibody (0S10O10) has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
UCP1/3
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol, 0.05% BSA
clonality :
Monoclonal
clone :
0S10O10
conjugate :
Unconjugated
host :
Rabbit
immunogen :
MVNPTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKV
RLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGL
PAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKI
SAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTG
TYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTY
DLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVD
VVKTRFINSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVA
SFLRLGSWNVIMFVCFEQLKKELMKSRQTVDCTT
Recombinant fusion protein containing a sequence corresponding to amino acids 1-307 of mouse UCP1/3 (P12242).,, Sequence:,
RLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGL
PAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKI
SAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTG
TYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTY
DLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVD
VVKTRFINSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVA
SFLRLGSWNVIMFVCFEQLKKELMKSRQTVDCTT
Recombinant fusion protein containing a sequence corresponding to amino acids 1-307 of mouse UCP1/3 (P12242).,, Sequence:,
isotype :
IgG
purity :
Affinity purified
species :
Mouse,Rat
theoretical molecular weight :
34 kDa
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
469 USD
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
browse more products
questions and comments
