product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
DDB1 Antibody (9L8X5)
catalog :
NBP3-16531-100ul
quantity :
100 ul (also 20 ul)
price :
429 USD
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
9L8X5
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-16531
SKU :
NBP3-16531-100ul
product name :
DDB1 Antibody (9L8X5)
unit size :
100 ul (also 20 ul)
description :
The DDB1 Antibody (9L8X5) from Novus is a rabbit monoclonal antibody to DDB1. This antibody reacts with human,mouse,rat. The DDB1 Antibody (9L8X5) has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
DDB1
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol, 0.05% BSA
clonality :
Monoclonal
clone :
9L8X5
conjugate :
Unconjugated
host :
Rabbit
immunogen :
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTE
RKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGS
GMKREATADDLIKVVEELTRIH
A synthetic peptide corresponding to a sequence within amino acids 1041-1140 of human DDB1 (NP_001914.3).
RKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGS
GMKREATADDLIKVVEELTRIH
A synthetic peptide corresponding to a sequence within amino acids 1041-1140 of human DDB1 (NP_001914.3).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
gene symbol :
DDB1
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
extended description :
Recombinant Monoclonal Antibody
USD :
429 USD
product details :
Recombinant Monoclonal Antibody
alt names :
damage-specific DNA binding protein 1 (127kD), damage-specific DNA binding protein 1, 127kDa, Damage-specific DNA-binding protein 1, DDB p127 subunit, DDBa, DNA damage-binding protein 1, DNA damage-binding protein a, HBV X-associated protein 1, UV-damaged DNA-binding factor, UV-damaged DNA-binding protein 1, UV-DDB 1, UV-DDB1, XAP1, XAP-1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE, XPE-BF, XPE-binding factor
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
