This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Chitinase 3-like 1/YKL-40 Antibody (7T1R3)
catalog :
NBP3-16077-100ul
quantity :
100 ul (also 20 ul)
price :
399 USD
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
7T1R3
reactivity :
human, mouse
application :
western blot, immunocytochemistry
product information
brand :
Novus
master code :
NBP3-16077
SKU :
NBP3-16077-100ul
product name :
Chitinase 3-like 1/YKL-40 Antibody (7T1R3)
unit size :
100 ul (also 20 ul)
seo description :
The Chitinase 3-like 1/YKL-40 Antibody (7T1R3) from Novus is a rabbit monoclonal antibody to Chitinase 3-like 1/YKL-40. This antibody reacts with human,mouse. The Chitinase 3-like 1/YKL-40 Antibody (7T1R3) has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence.
target :
Chitinase 3-like 1/YKL-40
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol, 0.05% BSA
clonality :
Monoclonal
clone :
7T1R3
conjugate :
Unconjugated
dilution :
Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
host :
Rabbit
immunogen :
PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKG
NQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQG
SFCGQDLRFPLTNAIKDALAAT
A synthetic peptide corresponding to a sequence within amino acids 284-383 of human Chitinase 3-like 1 (NP_001267.2).
NQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQG
SFCGQDLRFPLTNAIKDALAAT
A synthetic peptide corresponding to a sequence within amino acids 284-383 of human Chitinase 3-like 1 (NP_001267.2).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse
gene symbol :
CHI3L1
applications :
Western Blot,Immunocytochemistry/ Immunofluorescence
extended description :
Recombinant Monoclonal Antibody
USD :
399 USD
product details :
Recombinant Monoclonal Antibody
alt names :
AW208766, Brp39, Chi3l1, gp39, YKL-40
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
