product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Caspase-3 Antibody (7T1W5) - Active, Pro
catalog :
NBP3-15840-100ul
quantity :
100 ul (also 20 ul)
price :
429 USD
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
7T1W5
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry
more info or order :
product information
master code :
NBP3-15840
SKU :
NBP3-15840-100ul
product name :
Caspase-3 Antibody (7T1W5) - Active, Pro
unit size :
100 ul (also 20 ul)
description :
The Caspase-3 Antibody (7T1W5) - Active, Pro from Novus is a rabbit monoclonal antibody to Caspase-3. This antibody reacts with human,mouse,rat. The Caspase-3 Antibody (7T1W5) - Active, Pro has been validated for the following applications: Western Blot,Knockout Validated,Immunocytochemistry/ Immunofluorescence.
target :
Caspase-3
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol, 0.05% BSA
clonality :
Monoclonal
clone :
7T1W5
conjugate :
Unconjugated
host :
Rabbit
immunogen :
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGT
DVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKE
DHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRG
DRCRSLTGKPKLFIIQACRGTELDCGIETD
Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (P42574).
DVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKE
DHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRG
DRCRSLTGKPKLFIIQACRGTELDCGIETD
Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (P42574).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
gene symbol :
CASP3
Antibody validation :
Knockout/Knockdown
applications :
Western Blot,Knockout Validated,Immunocytochemistry/ Immunofluorescence
extended description :
Recombinant Monoclonal Antibody
USD :
429 USD
product details :
Recombinant Monoclonal Antibody
alt names :
Apopain, apoptosis-related cysteine protease, CASP-3, caspase 3, apoptosis-related cysteine peptidase, caspase-3, CPP-32, CPP32B, CPP32SREBP cleavage activity 1, Cysteine protease CPP32, EC 3.4.22, EC 3.4.22.56, PARP cleavage protease, procaspase3, Protein Yama, SCA-1, Yama
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
