product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)
catalog :
NBP3-15739-100ul
quantity :
100 ul (also 20 ul)
price :
399 USD
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
3Y1Y1
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-15739
SKU :
NBP3-15739-100ul
product name :
Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)
unit size :
100 ul (also 20 ul)
description :
The Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) from Novus is a rabbit monoclonal antibody to Hydrogen Potassium ATPase Beta. This antibody reacts with human,mouse,rat. The Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
Hydrogen Potassium ATPase Beta
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol, 0.05% BSA
clonality :
Monoclonal
clone :
3Y1Y1
conjugate :
Unconjugated
host :
Rabbit
immunogen :
SNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYF
PYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEH
VTFNNPHDPYEGKVEFKLKIEK
A synthetic peptide corresponding to a sequence within amino acids 192-291 of human Hydrogen Potassium ATPase Beta (P51164).
PYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEH
VTFNNPHDPYEGKVEFKLKIEK
A synthetic peptide corresponding to a sequence within amino acids 192-291 of human Hydrogen Potassium ATPase Beta (P51164).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
gene symbol :
ATP4B
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
extended description :
Recombinant Monoclonal Antibody
USD :
399 USD
product details :
Recombinant Monoclonal Antibody
alt names :
ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
