product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Choline Acetyltransferase/ChAT Antibody (1I4V0)
catalog :
NBP3-15621-100ul
quantity :
100 ul (also 20 ul)
price :
429 USD
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
1I4V0
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-15621
SKU :
NBP3-15621-100ul
product name :
Choline Acetyltransferase/ChAT Antibody (1I4V0)
unit size :
100 ul (also 20 ul)
description :
The Choline Acetyltransferase/ChAT Antibody (1I4V0) from Novus is a rabbit monoclonal antibody to Choline Acetyltransferase/ChAT. This antibody reacts with human,mouse,rat. The Choline Acetyltransferase/ChAT Antibody (1I4V0) has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Choline Acetyltransferase/ChAT
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol, 0.05% BSA
clonality :
Monoclonal
clone :
1I4V0
conjugate :
Unconjugated
host :
Rabbit
immunogen :
MSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPE
TILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLP
PTESKPLATKEKATRPSQGHQP
A synthetic peptide corresponding to a sequence within amino acids 649-748 of human Choline Acetyltransferase/ChAT (P28329).
TILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLP
PTESKPLATKEKATRPSQGHQP
A synthetic peptide corresponding to a sequence within amino acids 649-748 of human Choline Acetyltransferase/ChAT (P28329).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
theoretical molecular weight :
83 kDa
gene symbol :
CHAT
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
extended description :
Recombinant Monoclonal Antibody
USD :
429 USD
product details :
Recombinant Monoclonal Antibody
alt names :
acetyl CoA:choline O-acetyltransferase, ChAT, CHOACTase, Choline acetylase, choline acetyltransferase, choline O-acetyltransferase, CMS1A, CMS1A2, EC 2.3.1, EC 2.3.1.6
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
browse more products
questions and comments
