product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
HLA DQA1 Antibody (7W0M7)
catalog :
NBP3-15364-100ul
quantity :
100 ul (also 20 ul)
price :
429 USD
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
7W0M7
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-15364
SKU :
NBP3-15364-100ul
product name :
HLA DQA1 Antibody (7W0M7)
unit size :
100 ul (also 20 ul)
description :
The HLA DQA1 Antibody (7W0M7) from Novus is a rabbit monoclonal antibody to HLA DQA1. This antibody reacts with human,mouse,rat. The HLA DQA1 Antibody (7W0M7) has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
HLA DQA1
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol, 0.05% BSA
clonality :
Monoclonal
clone :
7W0M7
conjugate :
Unconjugated
host :
Rabbit
immunogen :
EGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHW
GLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIV
VGTVFIIRGLRSVGASRHQGPL
A synthetic peptide corresponding to a sequence within amino acids 155-254 of human HLA DQA1 (P01909).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
gene symbol :
HLA-DQA1
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
extended description :
Recombinant Monoclonal Antibody
USD :
429 USD
product details :
Recombinant Monoclonal Antibody
alt names :
CD, CELIAC1DQ alpha 1 chain, DC-1 alpha chain, DQ-A1, FLJ27088, FLJ27328, GSE, HLA class II histocompatibility antigen, DQ(W3) alpha chain, HLA-DCA, HLA-DQA, leucocyte antigen DQA1, leukocyte antigen alpha chain, major histocompatibility complex, class II, DQ alpha 1, MGC149527, MHC class II antigen, MHC class II DQA1, MHC class II HLA-D alpha glycoprotein, MHC class II HLA-DQ-alpha-1, MHC class II surface glycoprotein, MHC HLA-DQ alpha
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.