product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MMP-13 Antibody (8L8Q1)
catalog :
NBP3-15346-100ul
quantity :
100 ul (also 20 ul)
price :
399 USD
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
8L8Q1
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-15346
SKU :
NBP3-15346-100ul
product name :
MMP-13 Antibody (8L8Q1)
unit size :
100 ul (also 20 ul)
description :
The MMP-13 Antibody (8L8Q1) from Novus is a rabbit monoclonal antibody to MMP-13. This antibody reacts with human. The MMP-13 Antibody (8L8Q1) has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
MMP-13
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol, 0.05% BSA
clonality :
Monoclonal
clone :
8L8Q1
conjugate :
Unconjugated
host :
Rabbit
immunogen :
RGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHF
EDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGI
GDKVDAVYEKNGYIYFFNGPIQF
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MMP-13 (P45452).
EDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGI
GDKVDAVYEKNGYIYFFNGPIQF
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MMP-13 (P45452).
isotype :
IgG
purity :
Affinity purified
species :
Human
gene symbol :
MMP13
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
extended description :
Recombinant Monoclonal Antibody
USD :
399 USD
product details :
Recombinant Monoclonal Antibody
alt names :
CLG 3, CLG3EC 3.4.24, collagenase 3, EC 3.4.24.-, EC 3.4.24.22, EC 3.4.24.24, EC 3.4.24.35, EC 3.4.24.65, EC 3.4.24.7, MANDP1, matrix metallopeptidase 13 (collagenase 3), matrix metalloproteinase 13 (collagenase 3), Matrix metalloproteinase-13, MMP-13
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
