product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
GNB2 Antibody - BSA Free
catalog :
NBP3-04690-100ul
quantity :
100 ul (also 20 ul)
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP3-04690
SKU :
NBP3-04690-100ul
product name :
GNB2 Antibody - BSA Free
unit size :
100 ul (also 20 ul)
description :
The GNB2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to GNB2. This antibody reacts with human,mouse,rat. The GNB2 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
GNB2
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDP
VGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGK
LIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGL
DNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQ
IITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPD
GRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAF
FPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGI
TSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHD
NRVSCLGVTDDGMAVATGSWDSFLKIWN
Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human GNB2 (NP_005264.2).
VGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGK
LIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGL
DNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQ
IITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPD
GRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAF
FPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGI
TSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHD
NRVSCLGVTDDGMAVATGSWDSFLKIWN
Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human GNB2 (NP_005264.2).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
gene symbol :
GNB2
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
399 USD
alt names :
beta-2 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2, signal-transducing guanine nucleotide-binding regulatory protein beta subunit
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
