This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SPDEF Antibody - BSA Free
catalog :
NBP3-04686-100ul
quantity :
100 ul (also 20 ul)
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
citations: 1
| Reference |
|---|
product information
brand :
Novus Biologicals, a Bio-Techne Brand
catalog number base :
NBP3-04686
SKU :
NBP3-04686-100ul
product name :
SPDEF Antibody - BSA Free
Description :
The SPDEF Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SPDEF. This antibody reacts with human, rat. The SPDEF Antibody - BSA Free has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin.
target :
SPDEF
category :
Primary Antibodies
unit size :
100 ul (also 20 ul)
buffer :
PBS with 50% glycerol, pH7.3.
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLE
RRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAP
GASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEH
SLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQ
KWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRS
PLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEES
WTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLN
KEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQY
YKKGIIRKPDISQRLVYQFVHPI
Recombinant fusion protein containing a sequence corresponding to amino acids 1-335 of human SPDEF (NP_036523.1).
RRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAP
GASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEH
SLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQ
KWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRS
PLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEES
WTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLN
KEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQY
YKKGIIRKPDISQRLVYQFVHPI
Recombinant fusion protein containing a sequence corresponding to amino acids 1-335 of human SPDEF (NP_036523.1).
isotype :
IgG
purity :
Affinity purified
species :
Human, Rat
gene symbol :
SPDEF
applications :
Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
USD :
399 USD
alt names :
bA375E1.3, PDEFRP11-375E1__A.3, Prostate epithelium-specific Ets transcription factor, Prostate-derived Ets factor, Prostate-specific Ets, PSE, SAM pointed domain containing ets transcription factor, SAM pointed domain-containing Ets transcription factor
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
