product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Transglutaminase 5 Antibody - BSA Free
catalog :
NBP2-94524-0.1ml
quantity :
0.1 ml (also 0.02 ml)
price :
409 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
master code :
NBP2-94524
SKU :
NBP2-94524-0.1ml
product name :
Transglutaminase 5 Antibody - BSA Free
unit size :
0.1 ml (also 0.02 ml)
description :
The Transglutaminase 5 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Transglutaminase 5. This antibody reacts with human,mouse,rat. The Transglutaminase 5 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry.
target :
Transglutaminase 5
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
LQKLKARSFHGSQRGAELQPSRPTSLSQDSPRSLHTPSL
RPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKD
LKVNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPC
KISYSQYSQYLSTDKLIRISALGEEKSSPEKILVNKIIT
LSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVL
TVEGSGLFKKQQKVFLGVLKPQHQASIILETVPFKSGQR
QIQANMRSNKFKDIKGYRNVYVDFAL
Recombinant fusion protein containing a sequence corresponding to amino acids 461-720 of human TGM5 (NP_963925.2).
RPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKD
LKVNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPC
KISYSQYSQYLSTDKLIRISALGEEKSSPEKILVNKIIT
LSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVL
TVEGSGLFKKQQKVFLGVLKPQHQASIILETVPFKSGQR
QIQANMRSNKFKDIKGYRNVYVDFAL
Recombinant fusion protein containing a sequence corresponding to amino acids 461-720 of human TGM5 (NP_963925.2).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
gene symbol :
TGM5
applications :
Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry
USD :
409 USD
alt names :
EC 2.3.2.13, protein-glutamine gamma-glutamyltransferase 5, TG(X), TGase X, TGase-5, TGASE5, TGASEX, TGM6, TGMX, TGXMGC141907, transglutaminase 5, transglutaminase V, Transglutaminase X, transglutaminase-5
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
