product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ABCB7 Antibody - Azide and BSA Free
catalog :
NBP2-92864-0.1ml
quantity :
0.1 ml (also 0.02 ml)
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP2-92864
SKU :
NBP2-92864-0.1ml
product name :
ABCB7 Antibody - Azide and BSA Free
unit size :
0.1 ml (also 0.02 ml)
description :
The ABCB7 Antibody - Azide and BSA Free from Novus is a rabbit polyclonal antibody to ABCB7. This antibody reacts with human,mouse,rat. The ABCB7 Antibody - Azide and BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
ABCB7
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
AIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVS
LESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVY
AVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVA
IARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKH
RTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLAN
PHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKK
LQEEIVNSVKGCGNCSC
Recombinant fusion protein containing a sequence corresponding to amino acids 503-753 of human ABCB7 (NP_004290.2).
LESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVY
AVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVA
IARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKH
RTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLAN
PHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKK
LQEEIVNSVKGCGNCSC
Recombinant fusion protein containing a sequence corresponding to amino acids 503-753 of human ABCB7 (NP_004290.2).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
gene symbol :
ABCB7
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
399 USD
alt names :
ABC transporter 7 protein, ABC7ATP-binding cassette sub-family B member 7, mitochondrial, ASATATP-binding cassette 7, Atm1p, ATP-binding cassette transporter 7, ATP-binding cassette, sub-family B (MDR/TAP), member 7, EC 3.6.3, EC 3.6.3.42, EST140535
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
browse more products
questions and comments
