product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
DAAM2 Antibody - BSA Free
catalog :
NBP2-92809-0.1ml
quantity :
0.1 ml (also 0.02 ml)
price :
409 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunocytochemistry
more info or order :
product information
master code :
NBP2-92809
SKU :
NBP2-92809-0.1ml
product name :
DAAM2 Antibody - BSA Free
unit size :
0.1 ml (also 0.02 ml)
description :
The DAAM2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to DAAM2. This antibody reacts with human,mouse,rat. The DAAM2 Antibody - BSA Free has been validated for the following applications: ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence.
target :
DAAM2
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFS
SPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKW
QIYCSKKK
Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human DAAM2 (NP_056160.2).
SPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKW
QIYCSKKK
Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human DAAM2 (NP_056160.2).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
theoretical molecular weight :
123 kDa
gene symbol :
DAAM2
applications :
ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
USD :
409 USD
alt names :
dishevelled associated activator of morphogenesis 2
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
