product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CYLD Antibody - BSA Free
catalog :
NBP2-92436-0.1ml
quantity :
0.1 ml (also 0.02 ml)
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP2-92436
SKU :
NBP2-92436-0.1ml
product name :
CYLD Antibody - BSA Free
unit size :
0.1 ml (also 0.02 ml)
description :
The CYLD Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CYLD. This antibody reacts with human,mouse,rat. The CYLD Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
CYLD
category :
Primary Antibodies
buffer :
PBS (pH 7.3), 50% glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
TKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILR
VEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLL
EWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSL
ELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGK
IKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRH
GCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDS
MADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSR
RIQGCARRLLCDAYMCMYQSPTMSLYK
Recombinant fusion protein containing a sequence corresponding to amino acids 654-953 of human CYLD (NP_001035877.1).
VEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLL
EWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSL
ELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGK
IKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRH
GCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDS
MADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSR
RIQGCARRLLCDAYMCMYQSPTMSLYK
Recombinant fusion protein containing a sequence corresponding to amino acids 654-953 of human CYLD (NP_001035877.1).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
theoretical molecular weight :
107 kDa
gene symbol :
CYLD
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
399 USD
alt names :
CDMT, CYLD1MFT, CYLDI, cylindromatosis (turban tumor syndrome), Deubiquitinating enzyme CYLD, EAC, EC 3.1.2.15, EC 3.4.19.12, FLJ20180, FLJ31664, KIAA0849FLJ78684, MFT1, probable ubiquitin carboxyl-terminal hydrolase CYLD, SBS, TEM, ubiquitin carboxyl-terminal hydrolase CYLD, ubiquitin specific peptidase like 2, ubiquitin thioesterase CYLD, Ubiquitin thiolesterase CYLD, Ubiquitin-specific-processing protease CYLD, USPL2
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
