product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
FAM108A1 Antibody - BSA Free
catalog :
NBP2-84877-0.1ml
quantity :
0.1 ml
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
more info or order :
product information
master code :
NBP2-84877
SKU :
NBP2-84877-0.1ml
product name :
FAM108A1 Antibody - BSA Free
unit size :
0.1 ml
description :
The FAM108A1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to FAM108A1. This antibody reacts with human. The FAM108A1 Antibody - BSA Free has been validated for the following applications: Western Blot.
target :
FAM108A1
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFD
AFPNIEKVSKI
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM108A1. Peptide sequence:
purity :
Affinity purified
species :
Human
gene symbol :
ABHD17A
applications :
Western Blot
USD :
399 USD
alt names :
abhydrolase domain-containing protein FAM108A1, C19orf27, chromosome 19 open reading frame 27, EC 3.-, family with sequence similarity 108, member A1, MGC5244
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.