This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
FCRN/FCGRT Antibody (CL3638)
catalog :
NBP2-61626
quantity :
100 ul (also 25 ul)
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
CL3638
reactivity :
human
application :
immunohistochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP2-61626
SKU :
NBP2-61626
product name :
FCRN/FCGRT Antibody (CL3638)
description :
The FCRN/FCGRT Antibody (CL3638) from Novus Biologicals is a mouse monoclonal antibody to FCRN/FCGRT. This antibody reacts with human. The FCRN/FCGRT Antibody (CL3638) has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin.
target :
FCRN/FCGRT
unit size :
100 ul (also 25 ul)
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Monoclonal
clone :
CL3638
conjugate :
Unconjugated
host :
Mouse
immunogen :
LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSS
PGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPN
SDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELE
SPAKS
This antibody was developed against a recombinant protein corresponding to amino acids:
PGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPN
SDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELE
SPAKS
This antibody was developed against a recombinant protein corresponding to amino acids:
isotype :
IgG2a
purity :
Protein A purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
FCGRT
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin
USD :
519
USD 2025 :
499 USD
alt names :
alpha-chain, Fc fragment of IgG, receptor, transporter, alpha, FcRn, FcRn alpha chain, FCRNimmunoglobulin receptor, intestinal, heavy chain, IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, major histocompatibility complex class I-like Fc receptor, Neonatal Fc receptor, neonatal Fc-receptor for Ig
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
