product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
FAM21A Antibody - BSA Free
catalog :
NBP2-57472
quantity :
100 ul (also 25 ul)
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP2-57472
SKU :
NBP2-57472
product name :
FAM21A Antibody - BSA Free
unit size :
100 ul (also 25 ul)
description :
The FAM21A Antibody - BSA Free from Novus is a rabbit polyclonal antibody to FAM21A. This antibody reacts with human. The FAM21A Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
FAM21A
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
SVERTKPKAKIAENPANPPVGGKAKSPMFPALGEASSDD
DLFQSAKPKPAKKTNPFPLLEDEDDLFTDQKVKKNE
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:
DLFQSAKPKPAKKTNPFPLLEDEDDLFTDQKVKKNE
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:
isotype :
IgG
purity :
Affinity purified
species :
Human
gene symbol :
WASHC2A
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
Alternative Protein FAM21B, BA56A21.1, bA98I6.1, FAM21B, Family With Sequence Similarity 21 Member A, Family With Sequence Similarity 21, Member A, Family With Sequence Similarity 21, Member B, WASH Complex Subunit FAM21A, WASH Complex Subunit FAM21B
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
