product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MCT8/SLC16A2 Antibody - BSA Free
catalog :
NBP2-57308
quantity :
100 ul (also 25 ul)
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
MEM-97
reactivity :
human, mouse
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
Novus Biologicals product webpage
citations: 7
Reference
Wang Y, Wang T, Montero Pedrazuela A, Guada xf1 o Ferraz A, Rausell E. Thyroid Hormone Transporters MCT8 and OATP1C1 Are Expressed in Pyramidal Neurons and Interneurons in the Adult Motor Cortex of Human and Macaque Brain. Int J Mol Sci. 2023;24: pubmed publisher
Graffunder A, Paisdzior S, Opitz R, Renko K, Kühnen P, Biebermann H. Design and Characterization of a Fluorescent Reporter Enabling Live-cell Monitoring of MCT8 Expression. Exp Clin Endocrinol Diabetes. 2021;: pubmed publisher
Porst T, Johannes J, Gluschke H, K xf6 hler R, Mehl S, K xfc hnen P, et al. Natural Autoimmunity to the Thyroid Hormone Monocarboxylate Transporters MCT8 and MCT10. Biomedicines. 2021;9: pubmed publisher
Wilpert N, Krueger M, Opitz R, Sebinger D, Paisdzior S, Mages B, et al. Spatiotemporal Changes of Cerebral Monocarboxylate Transporter 8 Expression. Thyroid. 2020;: pubmed publisher
Faldyna M, Samankova P, Leva L, Cerny J, Oujezdska J, Rehakova Z, et al. Cross-reactive anti-human monoclonal antibodies as a tool for B-cell identification in dogs and pigs. Vet Immunol Immunopathol. 2007;119:56-62 pubmed
Brdicková N, Brdicka T, Angelisová P, Horváth O, Spicka J, Hilgert I, et al. LIME: a new membrane Raft-associated adaptor protein involved in CD4 and CD8 coreceptor signaling. J Exp Med. 2003;198:1453-62 pubmed
Polyak M, Deans J. Alanine-170 and proline-172 are critical determinants for extracellular CD20 epitopes; heterogeneity in the fine specificity of CD20 monoclonal antibodies is defined by additional requirements imposed by both amino acid sequence and quaternary struct. Blood. 2002;99:3256-62 pubmed
product information
master code :
NBP2-57308
SKU :
NBP2-57308
product name :
MCT8/SLC16A2 Antibody - BSA Free
unit size :
100 ul (also 25 ul)
description :
The MCT8/SLC16A2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to MCT8/SLC16A2. This antibody reacts with human,mouse. The MCT8/SLC16A2 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,IF/IHC,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
MCT8/SLC16A2
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEE
PI
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse
gene symbol :
SLC16A2
applications :
IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
DXS128, DXS128E, MCT 7, MCT 8, solute carrier family 16, member 2 (monocarboxylic acid transporter 8), XPCT
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.