product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Ki67/MKI67 Antibody - BSA Free
catalog :
NBP2-54656
quantity :
100 ul (also 25 ul)
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
OTI5E7
reactivity :
human
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP2-54656
SKU :
NBP2-54656
product name :
Ki67/MKI67 Antibody - BSA Free
unit size :
100 ul (also 25 ul)
description :
The Ki67/MKI67 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Ki67/MKI67. This antibody reacts with human. The Ki67/MKI67 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Ki67/MKI67
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
PAKVEDAADSATKPENLSSKTRGSIPTDVEVLPTETEIH
NEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLP
GLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFD
ENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIK
This KI67/MKI67 Antibody was developed against a Recombinant Protein corresponding to amino acids 402-55 from Human KI67/MKI67:
NEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLP
GLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFD
ENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIK
This KI67/MKI67 Antibody was developed against a Recombinant Protein corresponding to amino acids 402-55 from Human KI67/MKI67:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
theoretical molecular weight :
359 kDa
gene symbol :
MKI67
Antibody validation :
Orthogonal Validation
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
antigen identified by monoclonal Ki-67, antigen KI-67, Antigen Ki67, Ki67, Ki-67, KIA, Marker Of Proliferation Ki-67, MIB-, MIB-1, PPP1R105, Proliferation Marker Protein Ki-67, proliferation-related Ki-67 antigen, Protein Phosphatase 1, Regulatory Subunit 105
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
