This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MKL2 Antibody (CL1546)
catalog :
NBP2-52970
quantity :
0.1 ml (also 25 ul)
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
CL1546
reactivity :
human
application :
western blot, immunocytochemistry
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP2-52970
SKU :
NBP2-52970
product name :
MKL2 Antibody (CL1546)
description :
The MKL2 Antibody (CL1546) from Novus Biologicals is a mouse monoclonal antibody to MKL2. This antibody reacts with human. The MKL2 Antibody (CL1546) has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence.
target :
MKL2
unit size :
0.1 ml (also 25 ul)
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Monoclonal
clone :
CL1546
conjugate :
Unconjugated
host :
Mouse
immunogen :
QRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDF
SFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPV
TTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPT
NTVSSAKPGPALVKQSHPKNP
This antibody was developed against a recombinant protein corresponding to amino acids:
SFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPV
TTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPT
NTVSSAKPGPALVKQSHPKNP
This antibody was developed against a recombinant protein corresponding to amino acids:
isotype :
IgG1
purity :
Protein A purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
MKL2
applications :
Western Blot,Immunocytochemistry/ Immunofluorescence
USD :
519
USD 2025 :
499 USD
alt names :
DKFZp686J1745, FLJ31823, FLJ45623, KIAA1243, megakaryoblastic leukemia 2, MKL/myocardin-like 2, MKL/myocardin-like protein 2, MRTFB, MRTF-B, myocardin-related transcription factor B, NPD001
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
