product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Ferroportin/SLC40A1 Antibody - BSA Free
catalog :
NBP2-49454
quantity :
0.1 ml (also 25 ul)
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP2-49454
SKU :
NBP2-49454
product name :
Ferroportin/SLC40A1 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The Ferroportin/SLC40A1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Ferroportin/SLC40A1. This antibody reacts with human. The Ferroportin/SLC40A1 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Ferroportin/SLC40A1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNI
HELEHEQEPTCASQMAEPFRTFRDGWVSYYN
This Ferroportin/SLC40A1 Antibody was developed against a recombinant protein corresponding to amino acids:
HELEHEQEPTCASQMAEPFRTFRDGWVSYYN
This Ferroportin/SLC40A1 Antibody was developed against a recombinant protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
theoretical molecular weight :
62.5 kDa
gene symbol :
SLC40A1
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
Ferroportin-1, FPN1, FPN1IREG1ferroportin 1, HFE4, HFE4ferroportin-1, IREG1, iron regulated gene 1, Iron-regulated transporter 1, member 3, MST079, MSTP079, MTP1, putative ferroportin 1 variant IIIB, SLC11A3, SLC11A3iron regulated gene 1, solute carrier family 11 (proton-coupled divalent metal ion transporters), solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3, solute carrier family 40 (iron-regulated transporter), member 1, solute carrier family 40 member 1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
