product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Methionine Aminopeptidase 1D/MAP1D Antibody - BSA Free
catalog :
NBP2-48593
quantity :
0.1 ml (also 25 ul)
price :
499 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP2-48593
SKU :
NBP2-48593
product name :
Methionine Aminopeptidase 1D/MAP1D Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The Methionine Aminopeptidase 1D/MAP1D Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Methionine Aminopeptidase 1D/MAP1D. This antibody reacts with human. The Methionine Aminopeptidase 1D/MAP1D Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Methionine Aminopeptidase 1D/MAP1D
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
VGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTI
SHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA
This antibody was developed against a recombinant protein corresponding to amino acids:
SHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA
This antibody was developed against a recombinant protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
METAP1D
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
EC 3.4.11.18, MAP1DCDS of metAP-3 within PCR fragment, Metap1l, methionine aminopeptidase 1D, mitochondrial, methionyl aminopeptidase type 1D (mitochondrial), Methionyl aminopeptidase type 1D, mitochondrial
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
