This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MEKK1 Antibody (2F6) - IHC-Prediluted
catalog :
NBP2-48208
quantity :
7 ml
price :
399 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2F6
reactivity :
human
application :
immunohistochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP2-48208
SKU :
NBP2-48208
product name :
MEKK1 Antibody (2F6) - IHC-Prediluted
description :
The MEKK1 Antibody (2F6) - IHC-Prediluted from Novus Biologicals is a mouse monoclonal antibody to MEKK1. This antibody reacts with human. The MEKK1 Antibody (2F6) - IHC-Prediluted has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin.
target :
MEKK1
unit size :
7 ml
category :
Primary Antibodies
buffer :
10 mM PBS with 0.05% BSA
clonality :
Monoclonal
clone :
2F6
conjugate :
Unconjugated
host :
Mouse
immunogen :
(Uniprot: Q13233)
(SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFT
P-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSE
VAVLSPEKAENDDTYKDDVNHNQK)
Partial recombinant MEKK1 (aa1077-1176)
isotype :
IgG2a Kappa
purity :
Protein A or G purified
species :
Human
storage :
Store at 4C.
gene symbol :
MAP3K1
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin
USD :
419
USD 2025 :
399 USD
alt names :
Map3k1, MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.