This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
HIV-1 Gag p24 Antibody - BSA Free
catalog :
NBP2-41214
quantity :
0.1 mg (also 0.025 mg)
price :
409 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
Human immunodeficiency virus 1
application :
western blot, ELISA
citations: 1
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP2-41214
SKU :
NBP2-41214
product name :
HIV-1 Gag p24 Antibody - BSA Free
description :
The HIV-1 Gag p24 Antibody - BSA Free from Novus Biologicals is a rabbit polyclonal antibody to HIV-1 Gag p24. This antibody reacts with virus. The HIV-1 Gag p24 Antibody - BSA Free has been validated for the following applications: ELISA,Western Blot.
target :
HIV-1 Gag p24
unit size :
0.1 mg (also 0.025 mg)
category :
Primary Antibodies
buffer :
PBS
clonality :
Polyclonal
concentration :
1 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
pivqniqgqmvhqaisprtlnawvkvveekafspevipm
fsalsegatpqdlntmlntvgghqaamqmlketineeaa
ewdrvhpvhagpiapgqmreprgsdiagttstlqeqigw
mtnnppipvgeiykrwiilglnkivrmysptsildirqg
pkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
pdcktilkalgpaatleemmtacqgvggpghkarvla
Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence:
fsalsegatpqdlntmlntvgghqaamqmlketineeaa
ewdrvhpvhagpiapgqmreprgsdiagttstlqeqigw
mtnnppipvgeiykrwiilglnkivrmysptsildirqg
pkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
pdcktilkalgpaatleemmtacqgvggpghkarvla
Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence:
isotype :
IgG
purity :
Protein A purified
species :
Virus
specificity :
This antibody detects a 24 kDa recombinant protein
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
24 kDa
gene symbol :
gag
applications :
ELISA,Western Blot
USD :
399
USD 2025 :
409 USD
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
