Pax5/BSAP Antibody - BSA Free | Novus Biologicals NBP2-38790 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Pax5/BSAP Antibody - BSA Free

catalog :

NBP2-38790

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Port J, Yinda C, Riopelle J, Weishampel Z, Saturday T, Avanzato V, et al. Infection- or AZD1222 vaccine-mediated immunity reduces SARS-CoV-2 transmission but increases Omicron competitiveness in hamsters. Nat Commun. 2023;14:6592 pubmed publisher
Port J, Yinda C, Riopelle J, Weishampel Z, Saturday T, Avanzato V, et al. Infection- or vaccine mediated immunity reduces SARS-CoV-2 transmission, but increases competitiveness of Omicron in hamsters. bioRxiv. 2022;: pubmed publisher
Port J, Adney D, Schwarz B, Schulz J, Sturdevant D, Smith B, et al. High-Fat High-Sugar Diet-Induced Changes in the Lipid Metabolism Are Associated with Mildly Increased COVID-19 Severity and Delayed Recovery in the Syrian Hamster. Viruses. 2021;13: pubmed publisher
Port J, Adney D, Schwarz B, Schulz J, Sturdevant D, Smith B, et al. Western diet increases COVID-19 disease severity in the Syrian hamster. bioRxiv. 2021;: pubmed publisher
Tibaldi E, Gnudi F, Panzacchi S, Mandrioli D, Vornoli A, Manservigi M, et al. Identification of aspartame-induced haematopoietic and lymphoid tumours in rats after lifetime treatment. Acta Histochem. 2020;122:151548 pubmed publisher
Cunha A, Matheus F, Moretti M, Sampaio T, Poli A, Santos D, et al. Agmatine attenuates reserpine-induced oral dyskinesia in mice: Role of oxidative stress, nitric oxide and glutamate NMDA receptors. Behav Brain Res. 2016;312:64-76 pubmed publisher

product information

master code :

NBP2-38790

SKU :

NBP2-38790

product name :

Pax5/BSAP Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Pax5/BSAP Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Pax5/BSAP. This antibody reacts with hamster,human,rat. The Pax5/BSAP Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry-Paraffin,Immunohistochemistry,Western Blot.

target :

Pax5/BSAP

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFL
RKQMRGDLFTQQQL
This antibody was developed against a recombinant protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Hamster,Human,Rat

gene symbol :

PAX5

accessionNumbers :

Q02548

applications :

IF/IHC,Immunohistochemistry-Paraffin,Immunohistochemistry,Western Blot

USD :

559 USD

alt names :

B cell specific activator protein, B-cell-specific transcription factor, BSAPB-cell lineage specific activator, paired box 5, paired box gene 5 (B-cell lineage specific activator protein), paired box gene 5 (B-cell lineage specific activator), paired box homeotic gene 5, paired box protein Pax-5, transcription factor PAX 5

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage