product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CD11b Antibody (CL1719)
catalog :
NBP2-34490
quantity :
0.1 ml (also 25 ul)
price :
449 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
CL1719
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 2
| Reference |
|---|
product information
brand :
Novus
master code :
NBP2-34490
SKU :
NBP2-34490
product name :
CD11b Antibody (CL1719)
description :
The CD11b Antibody (CL1719) from NBP2-34490 is a nbp2-34490 antibody to . This antibody reacts with breast cancer, cancer, cell biology, cellular markers, glia markers, hematopoietic stem cell markers, immunology, innate immunity, microglia markers, myeloid cell markers, neuroscience, signal transduction, stem cell markers. The CD11b Antibody (CL1719) has been validated for the following applications: P11215.
target :
CD11b
category :
Primary Antibodies
unit sizes :
0.1 ml (also 25 ul)
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Monoclonal
clone :
CL1719
conjugate :
Unconjugated
host :
Mouse
immunogen :
LNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLVPVRL
NQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRK
APVVNCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDW
YIKTSHNHLLIVSTAEIL
Mouse Monoclonal CD11b Antibody (CL1719) was developed against a recombinant protein corresponding to amino acids:
NQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRK
APVVNCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDW
YIKTSHNHLLIVSTAEIL
Mouse Monoclonal CD11b Antibody (CL1719) was developed against a recombinant protein corresponding to amino acids:
isotype :
IgG1
purity :
Protein A purified
species :
Human
theoretical molecular weight :
127.2 kDa
gene symbol :
ITGAM
accessionNumbers :
P11215
applications :
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
USD :
449 USD
alt names :
antigen CD11b (p170), CD11 antigen-like family member B, CD11b, CD11b antigen, Cell surface glycoprotein MAC-1 subunit alpha, Complement component 3 receptor 3 subunit, CR-3 alpha chain, CR3A, CR3AMGC117044, integrin alpha-M, integrin, alpha M (complement component 3 receptor 3 subunit), Leukocyte adhesion receptor MO1, MAC-1, MAC1A, macrophage antigen alpha polypeptide, MO1A, Neutrophil adherence receptor, neutrophil adherence receptor alpha-M subunit, SLEB6
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
