CXCL8/IL-8 Antibody - BSA Free | Novus Biologicals NBP2-33819 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CXCL8/IL-8 Antibody - BSA Free

catalog :

NBP2-33819

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

33/2

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Lee S, Kim S, Kim Z, Lee J. Photodynamic Effects of Topical Photosensitizer, Photodithazine Using Micro-LED for Acne Bacteria Induced Inflammation. Ann Dermatol. 2024;36:329-340 pubmed publisher
Li L, Yao W, Yan S, Dong X, Lv Z, Jing Q, et al. Pan-Cancer Analysis of Prognostic and Immune Infiltrates for CXCs. Cancers (Basel). 2021;13: pubmed publisher
Hossain M, Marcus J, Lee J, Garcia P, Singh V, Shacka J, et al. Restoration of CTSD (cathepsin D) and lysosomal function in stroke is neuroprotective. Autophagy. 2020;:1-19 pubmed publisher
Owen Woods C, Joulia R, Barkaway A, Rolas L, Ma B, Nottebaum A, et al. Local microvascular leakage promotes trafficking of activated neutrophils to remote organs. J Clin Invest. 2020;130:2301-2318 pubmed publisher
Fronczek J, Lulf R, Korkmaz H, Witte B, van de Goot F, Begieneman M, et al. Analysis of inflammatory cells and mediators in skin wound biopsies to determine wound age in living subjects in forensic medicine. Forensic Sci Int. 2015;247:7-13 pubmed publisher
Capoccia B, Jin R, Kong Y, Peek R, Fassan M, Rugge M, et al. The ubiquitin ligase Mindbomb 1 coordinates gastrointestinal secretory cell maturation. J Clin Invest. 2013;123:1475-91 pubmed publisher
Garcia V, Kohen P, Maldonado C, Sierralta W, Muñoz A, Villarroel C, et al. Transient expression of progesterone receptor and cathepsin-l in human granulosa cells during the periovulatory period. Fertil Steril. 2012;97:707-13.e1 pubmed publisher
Zheng X, Chu F, Chou P, Gallati C, Dier U, Mirkin B, et al. Cathepsin L inhibition suppresses drug resistance in vitro and in vivo: a putative mechanism. Am J Physiol Cell Physiol. 2009;296:C65-74 pubmed publisher
Zheng X, Chou P, Mirkin B, Rebbaa A. Senescence-initiated reversal of drug resistance: specific role of cathepsin L. Cancer Res. 2004;64:1773-80 pubmed

product information

master code :

NBP2-33819

SKU :

NBP2-33819

product name :

CXCL8/IL-8 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CXCL8/IL-8 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CXCL8/IL-8. This antibody reacts with human. The CXCL8/IL-8 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

CXCL8/IL-8

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEI
IVKLSDGRELCLDPKENWVQRVVEKF
This antibody was developed against a recombinant protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

CXCL8

accessionNumbers :

P10145

applications :

Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

3-10C, AMCF-I, C-X-C motif chemokine 8, CXCL8SCYB8, Emoctakin, GCP-1TSG-1, interleukin 8, K60, LECT, MDNCFb-ENAP, member 8, MONAPGCP1, NAP-1NAP1, Neutrophil-activating protein 1, Protein 3-10C, T cell chemotactic factor, T-cell chemotactic factor

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage