product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
GSDMDC1 Antibody - BSA Free
catalog :
NBP2-33422
quantity :
0.1 ml (also 25 ul)
price :
579 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section, western blot knockout validation
more info or order :
citations: 104
Published Application/Species/Sample/DilutionReference
  • western blot; mouse; loading ...; fig 5b
  • western blot knockout validation; human; fig 5c
Okondo M, Johnson D, Sridharan R, Go E, Chui A, Wang M, et al. DPP8 and DPP9 inhibition induces pro-caspase-1-dependent monocyte and macrophage pyroptosis. Nat Chem Biol. 2017;13:46-53 pubmed publisher
  • western blot; human; loading ...; fig 1g
Fernández Duran I, Quintanilla A, Tarrats N, Birch J, Hari P, Millar F, et al. Cytoplasmic innate immune sensing by the caspase-4 non-canonical inflammasome promotes cellular senescence. Cell Death Differ. 2022;29:1267-1282 pubmed publisher
  • immunohistochemistry - frozen section; mouse; 1:500; loading ...; fig s1e
  • western blot; mouse; loading ...; fig 3a
  • immunohistochemistry - paraffin section; human; 1:500; loading ...; fig 1a
Zhang X, Wang R, Hu D, Sun X, Fujioka H, Lundberg K, et al. Oligodendroglial glycolytic stress triggers inflammasome activation and neuropathology in Alzheimer's disease. Sci Adv. 2020;6: pubmed publisher
  • western blot; human; loading ...; fig 3b
Johnson D, Taabazuing C, Okondo M, Chui A, Rao S, Brown F, et al. DPP8/DPP9 inhibitor-induced pyroptosis for treatment of acute myeloid leukemia. Nat Med. 2018;24:1151-1156 pubmed publisher
Sun Y, Lu Y, Liu L, Saaoud F, Shao Y, Xu K, et al. Caspase-4/11 promotes hyperlipidemia and chronic kidney disease-accelerated vascular inflammation by enhancing trained immunity. JCI Insight. 2024;9: pubmed publisher
Wang Y, Gao Y, Shi H, Gao R, Yang J, Qu Y, et al. CCL11 released by GSDMD-mediated macrophage pyroptosis regulates angiogenesis after hindlimb ischemia. Cell Death Discov. 2024;10:294 pubmed publisher
Lee C, Park M, Wijesinghe W, Na S, Lee C, Hwang E, et al. Oxidative photocatalysis on membranes triggers non-canonical pyroptosis. Nat Commun. 2024;15:4025 pubmed publisher
Wang Q, Clark K, Tiwari R, Raju N, Tharp G, Rogers J, et al. The CARD8 inflammasome dictates HIV/SIV pathogenesis and disease progression. Cell. 2024;187:1223-1237.e16 pubmed publisher
Zhan T, Tang S, Du J, Liu J, Yu B, Yang Y, et al. Implication of lncRNA MSTRG.81401 in Hippocampal Pyroptosis Induced by P2X7 Receptor in Type 2 Diabetic Rats with Neuropathic Pain Combined with Depression. Int J Mol Sci. 2024;25: pubmed publisher
Ye X, Lin J, Chen L, Wu X, Ma K, Li B, et al. SREBP1 deficiency diminishes glutamate-mediated HT22 cell damage and hippocampal neuronal pyroptosis induced by status epilepticus. Heliyon. 2024;10:e23945 pubmed publisher
Ran L, Ye T, Erbs E, Ehl S, Spassky N, Sumara I, et al. KCNN4 links PIEZO-dependent mechanotransduction to NLRP3 inflammasome activation. Sci Immunol. 2023;8:eadf4699 pubmed publisher
Ghait M, Duduskar S, Rooney M, H xe4 fner N, Reng L, G xf6 hrig B, et al. The non-canonical inflammasome activators Caspase-4 and Caspase-5 are differentially regulated during immunosuppression-associated organ damage. Front Immunol. 2023;14:1239474 pubmed publisher
Exconde P, Hernandez Chavez C, Bourne C, Richards R, Bray M, Lopez J, et al. The tetrapeptide sequence of IL-18 and IL-1β regulates their recruitment and activation by inflammatory caspases. Cell Rep. 2023;42:113581 pubmed publisher
Luo M, Peng Y, Lv D, Xue Y, Huang L, Hu Y, et al. LncRNA GAS5 downregulates NLRP3 inflammasome activation-mediated pyroptosis in sepsis-induced myocardial injury by targeting SIRT3/AMPKα. Heliyon. 2023;9:e22939 pubmed publisher
Pinilla M, Mazars R, Verg xe9 R, Gorse L, Paradis M, Suire B, et al. EEF2-inactivating toxins engage the NLRP1 inflammasome and promote epithelial barrier disruption. J Exp Med. 2023;220: pubmed publisher
Ding N, Xiao H, Zhen L, Li H, Zhang Z, Ge J, et al. Systemic cytokines inhibition with Imp7 siRNA nanoparticle ameliorates gut injury in a mouse model of ventilator-induced lung injury. Biomed Pharmacother. 2023;165:115237 pubmed publisher
Kim D, Ban K, Lee G, Jun H. Lysophosphatidic Acid Induces Podocyte Pyroptosis in Diabetic Nephropathy by an Increase of Egr1 Expression via Downregulation of EzH2. Int J Mol Sci. 2023;24: pubmed publisher
Yang Y, Yu Q, Li B, Yang Z, Zhang S, Yuan F. Palmitate lipotoxicity is closely associated with the fatty acid-albumin complexes in BV-2 microglia. PLoS ONE. 2023;18:e0281189 pubmed publisher
Du G, Healy L, David L, Walker C, Fontana P, Dong Y, et al. ROS-dependent palmitoylation is an obligate licensing modification for GSDMD pore formation. bioRxiv. 2023;: pubmed publisher
Park E, Choi H, Truong C, Jun H. The Inhibition of Autophagy and Pyroptosis by an Ethanol Extract of Nelumbo nucifera Leaf Contributes to the Amelioration of Dexamethasone-Induced Muscle Atrophy. Nutrients. 2023;15: pubmed publisher
Exconde P, Hernandez Chavez C, Bray M, Lopez J, Srivastava T, Egan M, et al. The tetrapeptide sequence of IL-1β regulates its recruitment and activation by inflammatory caspases. bioRxiv. 2023;: pubmed publisher
Wang Y, Pei S, Liu Z, Ding Y, Qian T, Wen H, et al. IRAK-M suppresses the activation of microglial NLRP3 inflammasome and GSDMD-mediated pyroptosis through inhibiting IRAK1 phosphorylation during experimental autoimmune encephalomyelitis. Cell Death Dis. 2023;14:103 pubmed publisher
Hu R, Liang J, Ding L, Zhang W, Wang Y, Zhang Y, et al. Gasdermin D inhibition ameliorates neutrophil mediated brain damage in acute ischemic stroke. Cell Death Discov. 2023;9:50 pubmed publisher
Chen Q, Wang A, Covelli D, Bhattacharjee A, Wang Q, Orth He E, et al. Optimized M24B Aminopeptidase Inhibitors for CARD8 Inflammasome Activation. J Med Chem. 2023;66:2589-2607 pubmed publisher
Orth He E, Huang H, Rao S, Wang Q, Chen Q, O Mara C, et al. Protein folding stress potentiates NLRP1 and CARD8 inflammasome activation. Cell Rep. 2023;42:111965 pubmed publisher
Wang Q, Hsiao J, Yardeny N, Huang H, O Mara C, Orth He E, et al. The NLRP1 and CARD8 inflammasomes detect reductive stress. Cell Rep. 2023;42:111966 pubmed publisher
Meyers A, Wang Z, Han W, Zhao Q, Zabalawi M, Duan L, et al. Pyruvate dehydrogenase kinase supports macrophage NLRP3 inflammasome activation during acute inflammation. Cell Rep. 2023;42:111941 pubmed publisher
Song Y, Guo F, Zhao Y, Ma X, Wu L, Yu J, et al. Novel lncRNA-prader willi/angelman region RNA, SNRPN neighbour (PWARSN) aggravates tubular epithelial cell pyroptosis by regulating TXNIP via dual way in diabetic kidney disease. Cell Prolif. 2023;56:e13349 pubmed publisher
Fan R, Jiang H, Hu Y, Xu Y, Zhou Y, Chen G, et al. Stomatin-like protein-2 attenuates macrophage pyroptosis and H9c2 cells apoptosis by protecting mitochondrial function. Biochem Biophys Res Commun. 2022;636:112-120 pubmed publisher
Ball D, Tsamouri L, Wang A, Huang H, Warren C, Wang Q, et al. Oxidized thioredoxin-1 restrains the NLRP1 inflammasome. Sci Immunol. 2022;7:eabm7200 pubmed publisher
Hu R, Liang J, Ding L, Zhang W, Liu X, Song B, et al. Edaravone dexborneol provides neuroprotective benefits by suppressing NLRP3 inflammasome-induced microglial pyroptosis in experimental ischemic stroke. Int Immunopharmacol. 2022;113:109315 pubmed publisher
Wang L, Yan H, Chen X, Lee J, Sun J, Liu G, et al. Caspase-8 is involved in pyroptosis, necroptosis and the maturation and release of IL-1β in Aspergillus fumigatus keratitis. Int Immunopharmacol. 2022;113:109275 pubmed publisher
Nadkarni R, Chu W, Lee C, Mohamud Y, Yap L, Toh G, et al. Viral proteases activate the CARD8 inflammasome in the human cardiovascular system. J Exp Med. 2022;219: pubmed publisher
Buscetta M, Cristaldi M, Cimino M, La Mensa A, Dino P, Bucchieri F, et al. Cigarette smoke promotes inflammasome-independent activation of caspase-1 and -4 leading to gasdermin D cleavage in human macrophages. FASEB J. 2022;36:e22525 pubmed publisher
Luo M, Hu Y, Lv D, Xie L, Yang S, Zuo D, et al. Recurrent Hypoglycemia Impaired Vascular Function in Advanced T2DM Rats by Inducing Pyroptosis. Oxid Med Cell Longev. 2022;2022:7812407 pubmed publisher
Chen W, Chen S, Yan C, Zhang Y, Zhang R, Chen M, et al. Allergen protease-activated stress granule assembly and gasdermin D fragmentation control interleukin-33 secretion. Nat Immunol. 2022;: pubmed publisher
Fan L, Liu H, Zhu G, Singh S, Yu Z, Wang S, et al. Caspase-4/11 is critical for angiogenesis by repressing Notch1 signalling via inhibiting γ-secretase activity. Br J Pharmacol. 2022;179:4809-4828 pubmed publisher
Lin W, Li L, Hsiao Y, Wong W, Chiu H, Hsu H, et al. Repositioning of the Angiotensin II Receptor Antagonist Candesartan as an Anti-Inflammatory Agent With NLRP3 Inflammasome Inhibitory Activity. Front Immunol. 2022;13:870627 pubmed publisher
Hsiao J, Neugroschl A, Chui A, Taabazuing C, Griswold A, Wang Q, et al. A ubiquitin-independent proteasome pathway controls activation of the CARD8 inflammasome. J Biol Chem. 2022;298:102032 pubmed publisher
Lian H, Fang X, Li Q, Liu S, Wei Q, Hua X, et al. NLRP3 Inflammasome-Mediated Pyroptosis Pathway Contributes to the Pathogenesis of Candida albicans Keratitis. Front Med (Lausanne). 2022;9:845129 pubmed publisher
Chu C, Wang B, Zhang Z, Liu W, Sun S, Liang G, et al. miR-513c-5p Suppression Aggravates Pyroptosis of Endothelial Cell in Deep Venous Thrombosis by Promoting Caspase-1. Front Cell Dev Biol. 2022;10:838785 pubmed publisher
Gritsenko A, D xed az Pino R, L xf3 pez Castej xf3 n G. NLRP3 inflammasome triggers interleukin-37 release from human monocytes. Eur J Immunol. 2022;52:1141-1157 pubmed publisher
Rao S, Chen Q, Wang Q, Orth He E, Saoi M, Griswold A, et al. M24B aminopeptidase inhibitors selectively activate the CARD8 inflammasome. Nat Chem Biol. 2022;18:565-574 pubmed publisher
Wang S, Luke C, Pak S, Shi V, Chen L, Moore J, et al. SERPINB3 (SCCA1) inhibits cathepsin L and lysoptosis, protecting cervical cancer cells from chemoradiation. Commun Biol. 2022;5:46 pubmed publisher
Luke C, Markovina S, Good M, Wight I, Thomas B, Linneman J, et al. Lysoptosis is an evolutionarily conserved cell death pathway moderated by intracellular serpins. Commun Biol. 2022;5:47 pubmed publisher
Lu P, Wang J, Chiu L, Huang Y, Hung C. Spleen tyrosine kinase regulates keratinocyte inflammasome activation and skin inflammation induced by UVB irradiation. Free Radic Biol Med. 2022;180:121-133 pubmed publisher
Lee T, Huang Y, Hsiao P, Chiu L, Chern S, Wu N. Critical roles of irradiance in the regulation of UVB-induced inflammasome activation and skin inflammation in human skin keratinocytes. J Photochem Photobiol B. 2022;226:112373 pubmed publisher
Zhao G, Li T, Liu X, Zhang T, Zhang Z, Kang L, et al. African swine fever virus cysteine protease pS273R inhibits pyroptosis by noncanonically cleaving gasdermin D. J Biol Chem. 2022;298:101480 pubmed publisher
Pastar I, Sawaya A, Marjanovic J, Burgess J, Strbo N, Rivas K, et al. Intracellular Staphylococcus aureus triggers pyroptosis and contributes to inhibition of healing due to perforin-2 suppression. J Clin Invest. 2021;131: pubmed publisher
Wen S, Deng F, Li L, Xu L, Li X, Fan Q. VX-765 ameliorates renal injury and fibrosis in diabetes by regulating caspase-1-mediated pyroptosis and inflammation. J Diabetes Investig. 2021;: pubmed publisher
Li Y, Wen C, Zhong J, Ling J, Jiang Q. Enterococcus faecalis OG1RF induces apoptosis in MG63 cells via caspase-3/-8/-9 without activation of caspase-1/GSDMD. Oral Dis. 2021;: pubmed publisher
Dhingra A, Sharp R, Kim T, Popov A, Ying G, Pietrofesa R, et al. Assessment of a Small Molecule Synthetic Lignan in Enhancing Oxidative Balance and Decreasing Lipid Accumulation in Human Retinal Pigment Epithelia. Int J Mol Sci. 2021;22: pubmed publisher
Sharif H, Hollingsworth L, Griswold A, Hsiao J, Wang Q, Bachovchin D, et al. Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment. Immunity. 2021;54:1392-1404.e10 pubmed publisher
Shi H, Gao Y, Dong Z, Yang J, Gao R, Li X, et al. GSDMD-Mediated Cardiomyocyte Pyroptosis Promotes Myocardial I/R Injury. Circ Res. 2021;129:383-396 pubmed publisher
Orzalli M, Prochera A, Payne L, Smith A, Garlick J, Kagan J. Virus-mediated inactivation of anti-apoptotic Bcl-2 family members promotes Gasdermin-E-dependent pyroptosis in barrier epithelial cells. Immunity. 2021;54:1447-1462.e5 pubmed publisher
Gomez A, Serrano A, Salero E, Tovar A, Amescua G, Galor A, et al. Tumor necrosis factor-alpha and interferon-gamma induce inflammasome-mediated corneal endothelial cell death. Exp Eye Res. 2021;207:108574 pubmed publisher
Hollingsworth L, Sharif H, Griswold A, Fontana P, Mintseris J, Dagbay K, et al. DPP9 sequesters the C terminus of NLRP1 to repress inflammasome activation. Nature. 2021;592:778-783 pubmed publisher
Xu W, Che Y, Zhang Q, Huang H, Ding C, Wang Y, et al. Apaf-1 Pyroptosome Senses Mitochondrial Permeability Transition. Cell Metab. 2021;33:424-436.e10 pubmed publisher
Boal Carvalho I, Mazel Sanchez B, Silva F, Garnier L, Yildiz S, Bonifacio J, et al. Influenza A viruses limit NLRP3-NEK7-complex formation and pyroptosis in human macrophages. EMBO Rep. 2020;:e50421 pubmed publisher
Lichtenegger S, Stiehler J, Saiger S, Zauner A, Kleinhappl B, Bernecker C, et al. Burkholderia pseudomallei triggers canonical inflammasome activation in a human primary macrophage-based infection model. PLoS Negl Trop Dis. 2020;14:e0008840 pubmed publisher
Gritsenko A, Yu S, Martín Sánchez F, Díaz Del Olmo I, Nichols E, Davis D, et al. Priming Is Dispensable for NLRP3 Inflammasome Activation in Human Monocytes In Vitro. Front Immunol. 2020;11:565924 pubmed publisher
Chui A, Griswold A, Taabazuing C, Orth E, Gai K, Rao S, et al. Activation of the CARD8 Inflammasome Requires a Disordered Region. Cell Rep. 2020;33:108264 pubmed publisher
Linder A, Bauernfried S, Cheng Y, Albanese M, Jung C, Keppler O, et al. CARD8 inflammasome activation triggers pyroptosis in human T cells. EMBO J. 2020;39:e105071 pubmed publisher
Johnson D, Okondo M, Orth E, Rao S, Huang H, Ball D, et al. DPP8/9 inhibitors activate the CARD8 inflammasome in resting lymphocytes. Cell Death Dis. 2020;11:628 pubmed publisher
Fei L, Jingyuan X, Fangte L, Huijun D, Liu Y, Ren J, et al. Preconditioning with rHMGB1 ameliorates lung ischemia-reperfusion injury by inhibiting alveolar macrophage pyroptosis via the Keap1/Nrf2/HO-1 signaling pathway. J Transl Med. 2020;18:301 pubmed publisher
Chen H, Gan X, Li Y, Gu J, Liu Y, Deng Y, et al. NLRP12- and NLRC4-mediated corneal epithelial pyroptosis is driven by GSDMD cleavage accompanied by IL-33 processing in dry eye. Ocul Surf. 2020;18:783-794 pubmed publisher
Taabazuing C, Griswold A, Bachovchin D. The NLRP1 and CARD8 inflammasomes. Immunol Rev. 2020;297:13-25 pubmed publisher
Beckwith K, Beckwith M, Ullmann S, S xe6 tra R, Kim H, Marstad A, et al. Plasma membrane damage causes NLRP3 activation and pyroptosis during Mycobacterium tuberculosis infection. Nat Commun. 2020;11:2270 pubmed publisher
Dombret C, Naulé L, Trouillet A, Parmentier C, Hardin Pouzet H, Mhaouty Kodja S. Effects of neural estrogen receptor beta deletion on social and mood-related behaviors and underlying mechanisms in male mice. Sci Rep. 2020;10:6242 pubmed publisher
Yang F, Zhu W, Cai X, Zhang W, Yu Z, Li X, et al. Minocycline alleviates NLRP3 inflammasome-dependent pyroptosis in monosodium glutamate-induced depressive rats. Biochem Biophys Res Commun. 2020;526:553-559 pubmed publisher
Wen S, Wang Z, Zhang C, Yang Y, Fan Q. Caspase-3 Promotes Diabetic Kidney Disease Through Gasdermin E-Mediated Progression to Secondary Necrosis During Apoptosis. Diabetes Metab Syndr Obes. 2020;13:313-323 pubmed publisher
Ball D, Taabazuing C, Griswold A, Orth E, Rao S, Kotliar I, et al. Caspase-1 interdomain linker cleavage is required for pyroptosis. Life Sci Alliance. 2020;3: pubmed publisher
Ma J, Ramachandran M, Jin C, Quijano Rubio C, Martikainen M, Yu D, et al. Characterization of virus-mediated immunogenic cancer cell death and the consequences for oncolytic virus-based immunotherapy of cancer. Cell Death Dis. 2020;11:48 pubmed publisher
Lee J, Jeon Y, Park S, Son C. An Adrenalectomy Mouse Model Reflecting Clinical Features for Chronic Fatigue Syndrome. Biomolecules. 2020;10: pubmed publisher
Grossi S, Fenini G, Kockmann T, Hennig P, Di Filippo M, Beer H. Inactivation of the cytoprotective major vault protein by caspase-1 and -9 in epithelial cells during apoptosis: caspase-1 and -9 inactivate the major vault protein. J Invest Dermatol. 2019;: pubmed publisher
Ren J, Isakova A, Friedmann D, Zeng J, Grutzner S, Pun A, et al. Single-cell transcriptomes and whole-brain projections of serotonin neurons in the mouse dorsal and median raphe nuclei. elife. 2019;8: pubmed publisher
Pandori W, Lima T, Mallya S, Kao T, Gov L, Lodoen M. Toxoplasma gondii activates a Syk-CARD9-NF-κB signaling axis and gasdermin D-independent release of IL-1β during infection of primary human monocytes. PLoS Pathog. 2019;15:e1007923 pubmed publisher
Burgener S, Leborgne N, Snipas S, Salvesen G, Bird P, Benarafa C. Cathepsin G Inhibition by Serpinb1 and Serpinb6 Prevents Programmed Necrosis in Neutrophils and Monocytes and Reduces GSDMD-Driven Inflammation. Cell Rep. 2019;27:3646-3656.e5 pubmed publisher
Chui A, Okondo M, Rao S, Gai K, Griswold A, Johnson D, et al. N-terminal degradation activates the NLRP1B inflammasome. Science. 2019;364:82-85 pubmed publisher
Kerr N, de Rivero Vaccari J, Umland O, Bullock M, Conner G, Dietrich W, et al. Human Lung Cell Pyroptosis Following Traumatic Brain Injury. Cells. 2019;8: pubmed publisher
Li Y, Li C, Xi W, Jin S, Wu Z, Jiang P, et al. Rostral and Caudal Ventral Tegmental Area GABAergic Inputs to Different Dorsal Raphe Neurons Participate in Opioid Dependence. Neuron. 2019;101:748-761.e5 pubmed publisher
Thier M, Hommerding O, Panten J, Pinna R, García González D, Berger T, et al. Identification of Embryonic Neural Plate Border Stem Cells and Their Generation by Direct Reprogramming from Adult Human Blood Cells. Cell Stem Cell. 2019;24:166-182.e13 pubmed publisher
Mejias N, Martinez C, Stephens M, de Rivero Vaccari J. Contribution of the inflammasome to inflammaging. J Inflamm (Lond). 2018;15:23 pubmed publisher
Semino C, Carta S, Gattorno M, Sitia R, Rubartelli A. Progressive waves of IL-1β release by primary human monocytes via sequential activation of vesicular and gasdermin D-mediated secretory pathways. Cell Death Dis. 2018;9:1088 pubmed publisher
Dosumu Johnson R, Cocoran A, Chang Y, Nattie E, Dymecki S. Acute perturbation of Pet1-neuron activity in neonatal mice impairs cardiorespiratory homeostatic recovery. elife. 2018;7: pubmed publisher
Soiza Reilly M, Meye F, Olusakin J, Telley L, Petit E, Chen X, et al. SSRIs target prefrontal to raphe circuits during development modulating synaptic connectivity and emotional behavior. Mol Psychiatry. 2019;24:726-745 pubmed publisher
Zhang Z, Shao X, Jiang N, Mou S, Gu L, Li S, et al. Caspase-11-mediated tubular epithelial pyroptosis underlies contrast-induced acute kidney injury. Cell Death Dis. 2018;9:983 pubmed publisher
Ehlinger D, Commons K. Cav1.2 L-type calcium channels regulate stress coping behavior via serotonin neurons. Neuropharmacology. 2019;144:282-290 pubmed publisher
Kulkarni H, Elvington M, Perng Y, Liszewski M, Byers D, Farkouh C, et al. Intracellular C3 Protects Human Airway Epithelial Cells from Stress-Associated Cell Death. Am J Respir Cell Mol Biol. 2018;: pubmed publisher
Ren J, Friedmann D, Xiong J, Liu C, Ferguson B, Weerakkody T, et al. Anatomically Defined and Functionally Distinct Dorsal Raphe Serotonin Sub-systems. Cell. 2018;175:472-487.e20 pubmed publisher
Evavold C, Ruan J, Tan Y, Xia S, Wu H, Kagan J. The Pore-Forming Protein Gasdermin D Regulates Interleukin-1 Secretion from Living Macrophages. Immunity. 2018;48:35-44.e6 pubmed publisher
Thurgate C. Supporting those who work and learn: A phenomenological research study. Nurse Educ Today. 2018;61:83-88 pubmed publisher
Ma J, Wang F, Yang J, Dong Y, Su G, Zhang K, et al. Xiaochaihutang attenuates depressive/anxiety-like behaviors of social isolation-reared mice by regulating monoaminergic system, neurogenesis and BDNF expression. J Ethnopharmacol. 2017;208:94-104 pubmed publisher
Natarajan R, Forrester L, Chiaia N, Yamamoto B. Chronic-Stress-Induced Behavioral Changes Associated with Subregion-Selective Serotonin Cell Death in the Dorsal Raphe. J Neurosci. 2017;37:6214-6223 pubmed publisher
Taabazuing C, Okondo M, Bachovchin D. Pyroptosis and Apoptosis Pathways Engage in Bidirectional Crosstalk in Monocytes and Macrophages. Cell Chem Biol. 2017;24:507-514.e4 pubmed publisher
Pomeranz L, Ekstrand M, Latcha K, Smith G, Enquist L, Friedman J. Gene Expression Profiling with Cre-Conditional Pseudorabies Virus Reveals a Subset of Midbrain Neurons That Participate in Reward Circuitry. J Neurosci. 2017;37:4128-4144 pubmed publisher
Goto S, Ogi H, Fushiki S, Itoh K. Prenatal and lactational bisphenol A exposure does not alter serotonergic neurons morphologically in the murine dorsal raphe nucleus. Brain Dev. 2017;39:475-482 pubmed publisher
Liu X, Zhang Z, Ruan J, Pan Y, Magupalli V, Wu H, et al. Inflammasome-activated gasdermin D causes pyroptosis by forming membrane pores. Nature. 2016;535:153-8 pubmed publisher
Coyle D, Murphy J, Doyle B, O Donnell A, Gillick J, Puri P. Altered tryptophan hydroxylase 2 expression in enteric serotonergic nerves in Hirschsprung's-associated enterocolitis. World J Gastroenterol. 2016;22:4662-72 pubmed publisher
Barrett K, Dosumu Johnson R, Daubenspeck J, Brust R, Kreouzis V, Kim J, et al. Partial Raphe Dysfunction in Neurotransmission Is Sufficient to Increase Mortality after Anoxic Exposures in Mice at a Critical Period in Postnatal Development. J Neurosci. 2016;36:3943-53 pubmed publisher
Commons K. Ascending serotonin neuron diversity under two umbrellas. Brain Struct Funct. 2016;221:3347-60 pubmed publisher
Alter S, Stout K, Lohr K, Taylor T, Shepherd K, Wang M, et al. Reduced vesicular monoamine transport disrupts serotonin signaling but does not cause serotonergic degeneration. Exp Neurol. 2016;275 Pt 1:17-24 pubmed publisher
Shi J, Zhao Y, Wang K, Shi X, Wang Y, Huang H, et al. Cleavage of GSDMD by inflammatory caspases determines pyroptotic cell death. Nature. 2015;526:660-5 pubmed publisher
Näslund J, Studer E, Pettersson R, Hagsäter M, Nilsson S, Nissbrandt H, et al. Differences in Anxiety-Like Behavior within a Batch of Wistar Rats Are Associated with Differences in Serotonergic Transmission, Enhanced by Acute SRI Administration, and Abolished By Serotonin Depletion. Int J Neuropsychopharmacol. 2015;18: pubmed publisher
product information
master code :
NBP2-33422
SKU :
NBP2-33422
product name :
GSDMDC1 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The Gasdermin D Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Gasdermin D. This antibody reacts with human,mouse,porcine,rat. The Gasdermin D Antibody - BSA Free has been validated for the following applications: Western Blot,Immunoprecipitation,Immunocytochemistry/ Immunofluorescence,Simple Western,Chemotaxis,IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockout Validated,Knockdown Validated.
target :
GSDMDC1
category :
Primary Antibodies
buffer :
PBS (pH 7.2), 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCL
QGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLL
FPDKKQRTFQPPATGHKRSTS
This antibody was developed against a recombinant protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Porcine,Rat
gene symbol :
GSDMD
Antibody validation :
Orthogonal Validation
accessionNumbers :
P57764
applications :
Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence,Simple Western,Chemotaxis,IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockout Validated,Knockdown Validated
USD :
579 USD
alt names :
DF5L, DFNA5L, FLJ12150, gasdermin D, gasdermin domain containing 1, Gasdermin domain-containing protein 1, gasdermin-D, GSDMD N, GSDMDC1, GSDMD-N
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.