FCHO2 Antibody - BSA Free | Novus Biologicals NBP2-32694 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

FCHO2 Antibody - BSA Free

catalog :

NBP2-32694

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

Vicky-1

reactivity :

human

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:700; loading ...; fig 7c	Traub L. A nanobody-based molecular toolkit provides new mechanistic insight into clathrin-coat initiation. elife. 2019;8: pubmed publisher
	Zaccai N, Kadlecova Z, Dickson V, Korobchevskaya K, Kamenicky J, Kovtun O, et al. FCHO controls AP2's initiating role in endocytosis through a PtdIns(4,5)P2-dependent switch. Sci Adv. 2022;8:eabn2018 pubmed publisher
	El Alaoui F, Casuso I, Sanchez Fuentes D, Arpin André C, Rathar R, Baecker V, et al. Structural organization and dynamics of FCHo2 docking on membranes. elife. 2022;11: pubmed publisher
	Wang X, Chen Z, Mettlen M, Noh J, Schmid S, Danuser G. DASC, a sensitive classifier for measuring discrete early stages in clathrin-mediated endocytosis. elife. 2020;9: pubmed publisher
	Sochacki K, Dickey A, Strub M, Taraska J. Endocytic proteins are partitioned at the edge of the clathrin lattice in mammalian cells. Nat Cell Biol. 2017;19:352-361 pubmed publisher
	Lyu M, Rai D, Ahn K, Sung B, Cheung L, Marks J, et al. The rGel/BLyS fusion toxin inhibits diffuse large B-cell lymphoma growth in vitro and in vivo. Neoplasia. 2010;12:366-75 pubmed
	Koarada S, Tada Y, Sohma Y, Haruta Y, Suematsu R, Mitamura M, et al. Autoantibody-producing RP105(-) B cells, from patients with systemic lupus erythematosus, showed more preferential expression of BCMA compared with BAFF-R than normal subjects. Rheumatology (Oxford). 2010;49:662-70 pubmed publisher
	Sakurai D, Hase H, Kanno Y, Kojima H, Okumura K, Kobata T. TACI regulates IgA production by APRIL in collaboration with HSPG. Blood. 2007;109:2961-7 pubmed

product information

master code :

NBP2-32694

SKU :

NBP2-32694

product name :

FCHO2 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The FCHO2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to FCHO2. This antibody reacts with human. The FCHO2 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western,Knockout Validated.

target :

FCHO2

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQ
DIEETHLIHIKEIIGSLSNAIKEIHLQIG
This antibody was developed against a recombinant protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

FCHO2

Antibody validation :

Independent Anitbodies

applications :

Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western,Knockout Validated

USD :

559 USD

alt names :

FCH domain only 2

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage