This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MGC4172 Antibody
catalog :
NBP2-30577
quantity :
0.1 ml (also 25 ul)
price :
499 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP2-30577
SKU :
NBP2-30577
product name :
MGC4172 Antibody
description :
The MGC4172 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MGC4172. This antibody reacts with human. The MGC4172 Antibody has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin.
target :
MGC4172
unit size :
0.1 ml (also 25 ul)
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
EGLRQELREAQTHIRATCISPGVVETQFAFKLHDKDPEK
AAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRP
TEQVT
This antibody was developed against a recombinant protein corresponding to amino acids:
AAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRP
TEQVT
This antibody was developed against a recombinant protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
DHRS11
Antibody validation :
Orthogonal Validation
accessionNumbers :
Q6UWP2
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin
USD :
519
USD 2025 :
499 USD
alt names :
ARPG836, dehydrogenase/reductase (SDR family) member 11, dehydrogenase/reductase SDR family member 11, FLJ39232, MGC4172, SDR24C1, short chain dehydrogenase/reductase family 24C, member 1, short-chain dehydrogenase/reductase
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
