product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ZG16 Antibody
catalog :
NBP2-30488
quantity :
0.1 ml
price :
499 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
image
image 1 :

Western Blot: ZG16 Antibody [NBP2-30488] - Analysis in control (vector only transfected HEK293T lysate) and ZG16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP2-30488
SKU :
NBP2-30488
product name :
ZG16 Antibody
description :
The ZG16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZG16. This antibody reacts with human. The ZG16 Antibody has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
ZG16
unit size :
0.1 ml
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
QVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLH
PNTVLRFISGRSGSLIDAIGLHWDVYPTS
This antibody was developed against a recombinant protein corresponding to amino acids:
PNTVLRFISGRSGSLIDAIGLHWDVYPTS
This antibody was developed against a recombinant protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
ZG16
Antibody validation :
Independent Antibodies
accessionNumbers :
O60844
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
519
USD 2025 :
499 USD
alt names :
hZG16, JCLN, JCLN1, MGC34820, ZG16A
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
