Acrosin Antibody - BSA Free | Novus Biologicals NBP2-14260 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Acrosin Antibody - BSA Free

catalog :

NBP2-14260

quantity :

0.1 ml (also 25 ul)

price :

519 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

CD7D5

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 12

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; rat; 1:2500; loading ...; fig 3c	Nakamura N, Sloper D. Comparison of germ cell differentiation of rat testis fragments cultured in knockout serum replacement versus Albumax™ I. Birth Defects Res. 2021;113:359-370 pubmed publisher
	Hua R, Xue R, Liu Y, Li Y, Sha X, Li K, et al. ACROSIN deficiency causes total fertilization failure in humans by preventing the sperm from penetrating the zona pellucida. Hum Reprod. 2023;38:1213-1223 pubmed publisher
	Yu H, Shi X, Shao Z, Geng H, Guo S, Li K, et al. Novel HYDIN variants associated with male infertility in two Chinese families. Front Endocrinol (Lausanne). 2023;14:1118841 pubmed publisher
	Ma Y, Chen J, Li H, Xu F, Chong T, Wang Z, et al. Immature rat testis sustained long-term development using an integrative model. Biol Res. 2022;55:30 pubmed publisher
	Yang T, Chen Y, Chen G, Sun Y, Li Z, Shen X, et al. Sperm-specific protein ACTL7A as a biomarker for fertilization outcomes of assisted reproductive technology. Asian J Androl. 2022;24:260-265 pubmed publisher
	Yang T, Chen Y, Chen G, Sun Y, Li Z, Shen X, et al. Sperm-specific protein ACTL7A as a biomarker for fertilization outcomes of assisted reproductive technology. Asian J Androl. 2022;: pubmed publisher
	Zhao Q, Huang J, Cheng Y, Dai M, Zhu W, Yang X, et al. Polyamine metabolism links gut microbiota and testicular dysfunction. Microbiome. 2021;9:224 pubmed publisher
	Sawaied A, Arazi E, AbuElhija A, Lunenfeld E, Huleihel M. The Presence of Colony-Stimulating Factor-1 and Its Receptor in Different Cells of the Testis; It Involved in the Development of Spermatogenesis In Vitro. Int J Mol Sci. 2021;22: pubmed publisher
	Sawaied A, Lunenfeld E, Huleihel M. Interleukin-34, a Novel Paracrine/Autocrine Factor in Mouse Testis, and Its Possible Role in the Development of Spermatogonial Cells In Vitro. Int J Mol Sci. 2020;21: pubmed publisher
	Xin A, Qu R, Chen G, Zhang L, Chen J, Tao C, et al. Disruption in ACTL7A causes acrosomal ultrastructural defects in human and mouse sperm as a novel male factor inducing early embryonic arrest. Sci Adv. 2020;6:eaaz4796 pubmed publisher
	Nakamura N, Merry G, Inselman A, Sloper D, Del Valle P, Sato T, et al. Evaluation of Culture Time and Media in an In Vitro Testis Organ Culture System. Birth Defects Res. 2017;109:465-474 pubmed publisher
	Reda A, Hou M, Winton T, Chapin R, SÃ¶der O, Stukenborg J. In vitro differentiation of rat spermatogonia into round spermatids in tissue culture. Mol Hum Reprod. 2016;22:601-12 pubmed publisher

product information

master code :

NBP2-14260

SKU :

NBP2-14260

product name :

Acrosin Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Acrosin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Acrosin. This antibody reacts with human,mouse,rat. The Acrosin Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,IF/IHC,Western Blot,Immunohistochemistry-Paraffin.

target :

Acrosin

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKID
TCQ
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

ACR

Antibody validation :

Orthogonal Validation

accessionNumbers :

P10323

applications :

Immunocytochemistry/ Immunofluorescence,IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin

USD :

519 USD

alt names :

acrosin, ACRS, preproacrosin, proacrosin

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage