product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Acrosin Antibody - BSA Free
catalog :
NBP2-14260
quantity :
0.1 ml (also 25 ul)
price :
519 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
CD7D5
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 13
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry - paraffin section; rat; 1:2500; loading ...; fig 3c
Nakamura N, Sloper D. Comparison of germ cell differentiation of rat testis fragments cultured in knockout serum replacement versus Albumax™ I. Birth Defects Res. 2021;113:359-370 pubmed publisher
Shao Z, Zhu Y, Gu M, Guo S, Yu H, Li K, et al. Novel variants in DNAH6 cause male infertility associated with multiple morphological abnormalities of the sperm flagella (MMAF) and ICSI outcomes. Asian J Androl. 2024;26:91-98 pubmed publisher
Hua R, Xue R, Liu Y, Li Y, Sha X, Li K, et al. ACROSIN deficiency causes total fertilization failure in humans by preventing the sperm from penetrating the zona pellucida. Hum Reprod. 2023;38:1213-1223 pubmed publisher
Yu H, Shi X, Shao Z, Geng H, Guo S, Li K, et al. Novel HYDIN variants associated with male infertility in two Chinese families. Front Endocrinol (Lausanne). 2023;14:1118841 pubmed publisher
Ma Y, Chen J, Li H, Xu F, Chong T, Wang Z, et al. Immature rat testis sustained long-term development using an integrative model. Biol Res. 2022;55:30 pubmed publisher
Yang T, Chen Y, Chen G, Sun Y, Li Z, Shen X, et al. Sperm-specific protein ACTL7A as a biomarker for fertilization outcomes of assisted reproductive technology. Asian J Androl. 2022;24:260-265 pubmed publisher
Yang T, Chen Y, Chen G, Sun Y, Li Z, Shen X, et al. Sperm-specific protein ACTL7A as a biomarker for fertilization outcomes of assisted reproductive technology. Asian J Androl. 2022;: pubmed publisher
Zhao Q, Huang J, Cheng Y, Dai M, Zhu W, Yang X, et al. Polyamine metabolism links gut microbiota and testicular dysfunction. Microbiome. 2021;9:224 pubmed publisher
Sawaied A, Arazi E, AbuElhija A, Lunenfeld E, Huleihel M. The Presence of Colony-Stimulating Factor-1 and Its Receptor in Different Cells of the Testis; It Involved in the Development of Spermatogenesis In Vitro. Int J Mol Sci. 2021;22: pubmed publisher
Sawaied A, Lunenfeld E, Huleihel M. Interleukin-34, a Novel Paracrine/Autocrine Factor in Mouse Testis, and Its Possible Role in the Development of Spermatogonial Cells In Vitro. Int J Mol Sci. 2020;21: pubmed publisher
Xin A, Qu R, Chen G, Zhang L, Chen J, Tao C, et al. Disruption in ACTL7A causes acrosomal ultrastructural defects in human and mouse sperm as a novel male factor inducing early embryonic arrest. Sci Adv. 2020;6:eaaz4796 pubmed publisher
Nakamura N, Merry G, Inselman A, Sloper D, Del Valle P, Sato T, et al. Evaluation of Culture Time and Media in an In Vitro Testis Organ Culture System. Birth Defects Res. 2017;109:465-474 pubmed publisher
Reda A, Hou M, Winton T, Chapin R, Söder O, Stukenborg J. In vitro differentiation of rat spermatogonia into round spermatids in tissue culture. Mol Hum Reprod. 2016;22:601-12 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP2-14260
SKU :
NBP2-14260
product name :
Acrosin Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Acrosin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Acrosin. This antibody reacts with human,mouse,rat. The Acrosin Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Acrosin
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
LMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKID
TCQ
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
gene symbol :
ACR
Antibody validation :
Orthogonal Validation
accessionNumbers :
P10323
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
519 USD
alt names :
acrosin, ACRS, preproacrosin, proacrosin
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.